Property Summary

NCBI Gene PubMed Count 13
PubMed Score 47.09
PubTator Score 10.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Gene RIF (4)

AA Sequence

MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESL      1 - 70
EQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR                  71 - 127
//

Text Mined References (17)

PMID Year Title