Property Summary

NCBI Gene PubMed Count 12
Grant Count 12
R01 Count 7
Funding $596,037.81
PubMed Score 35.16
PubTator Score 10.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
26034174 Batf3-dependent dendritic cells elicit the rejection of cells and grafts expressing mismatched minor histocompatibility antigens.
15467742 overexpression of p21SNFT in HepG2 cells leads to repression of matrix metalloproteinase-1 by 70-80%
12087103 correlation of transcriptional repression by p21(SNFT) with changes in DNA.NF-AT complex interactions

AA Sequence

MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESL      1 - 70
EQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR                  71 - 127
//

Text Mined References (16)

PMID Year Title
26034174 2015 Cutting Edge: Roles for Batf3-Dependent APCs in the Rejection of Minor Histocompatibility Antigen-Mismatched Grafts.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467742 2004 Transcriptional repression of MMP-1 by p21SNFT and reduced in vitro invasiveness of hepatocarcinoma cells.
More...