Property Summary

NCBI Gene PubMed Count 33
PubMed Score 16.31
PubTator Score 12.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

AA Sequence

MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQKALCAEFKMK      1 - 70
MKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDLFRAYDASLAMLMRKGQDSIE     71 - 140
PVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYCLKKY    141 - 210
IVDFLMENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDA    211 - 280
CWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKH    281 - 350
LVGVDSLIGPETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD    351 - 420
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI                                          421 - 452
//

Text Mined References (38)

PMID Year Title