Property Summary

NCBI Gene PubMed Count 20
Grant Count 10
R01 Count 10
Funding $565,855.09
PubMed Score 4.61
PubTator Score 5.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis -1.400 0.044
esophageal adenocarcinoma -1.100 0.018
cutaneous lupus erythematosus -1.100 0.000
psoriasis -2.000 0.001
glioblastoma -1.300 0.029
oligodendroglioma -1.100 0.000
osteosarcoma -1.251 0.000
astrocytoma -1.500 0.009
atypical teratoid / rhabdoid tumor -1.100 0.000
interstitial cystitis -2.000 0.001
adult high grade glioma -1.500 0.006
group 3 medulloblastoma -1.400 0.040
subependymal giant cell astrocytoma -2.428 0.005
Pick disease -1.600 0.000
pterygium -1.200 0.016

Gene RIF (3)

PMID Text
23921385 the potential importance of the endophilin B2-plectin complex in the biological functions depending on nuclear migration and positioning.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18303116 identified a nonmutated HLA-A2-binding epitope in the human ortholog SH3GLB2, which primed T cells from healthy HLA-A2(+) individuals

AA Sequence

MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSA      1 - 70
RVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISF     71 - 140
LTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALW    141 - 210
NDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGR    211 - 280
FPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAAD    281 - 350
SSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS                             351 - 395
//

Text Mined References (23)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
23921385 2013 The Bin/amphiphysin/Rvs (BAR) domain protein endophilin B2 interacts with plectin and controls perinuclear cytoskeletal architecture.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
21266059 2011 Tumor-suppressor activity of RRIG1 in breast cancer.
20562859 2010 Network organization of the human autophagy system.
More...