Property Summary

NCBI Gene PubMed Count 24
PubMed Score 6.79
PubTator Score 5.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.500 5.9e-03
astrocytoma -1.500 9.1e-03
atypical teratoid / rhabdoid tumor -1.100 4.9e-07
cutaneous lupus erythematosus -1.100 4.4e-04
esophageal adenocarcinoma -1.100 1.8e-02
glioblastoma -1.100 9.4e-04
group 3 medulloblastoma -1.400 4.0e-02
interstitial cystitis -1.200 2.9e-02
oligodendroglioma -1.100 1.4e-13
osteosarcoma -1.251 4.1e-08
Pick disease -1.600 3.7e-04
psoriasis -2.000 8.7e-04
pterygium -1.200 1.6e-02
Rheumatoid arthritis -1.400 4.4e-02
subependymal giant cell astrocytoma -2.428 5.0e-03

Gene RIF (5)

AA Sequence

MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSA      1 - 70
RVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISF     71 - 140
LTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALW    141 - 210
NDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGR    211 - 280
FPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAAD    281 - 350
SSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS                             351 - 395
//

Text Mined References (27)

PMID Year Title