Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.18
PubTator Score 357.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.300 3.5e-02
diabetes mellitus -1.100 1.3e-03
group 4 medulloblastoma -2.200 4.3e-06
lung carcinoma -1.500 5.2e-27
medulloblastoma, large-cell -1.100 3.0e-03
non primary Sjogren syndrome sicca 1.200 1.7e-02
oligodendroglioma -1.500 3.4e-02
ovarian cancer 1.300 4.0e-04
tuberculosis 1.200 8.2e-07

Gene RIF (1)

AA Sequence

MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARA      1 - 70
AELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD                            71 - 117
//

Text Mined References (13)

PMID Year Title