Property Summary

NCBI Gene PubMed Count 32
PubMed Score 13.15
PubTator Score 203.72

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer 1.300 9.9e-12
cystic fibrosis -1.409 1.5e-05
glioblastoma 1.700 1.6e-03
Multiple myeloma 1.535 2.4e-03
osteosarcoma -1.179 3.7e-03
ovarian cancer -1.700 3.1e-06
pediatric high grade glioma 1.100 7.7e-05
Polycystic ovary syndrome 1.120 4.7e-02
primary pancreatic ductal adenocarcinoma 1.005 8.7e-03
psoriasis -1.200 2.8e-03

 GO Function (1)

Gene RIF (17)

AA Sequence

MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT      1 - 70
FTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNKIDRTD     71 - 140
AISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID                141 - 198
//

Text Mined References (41)

PMID Year Title