Property Summary

NCBI Gene PubMed Count 28
Grant Count 95
R01 Count 63
Funding $10,101,055.19
PubMed Score 12.00
PubTator Score 203.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.535 0.002
psoriasis -1.200 0.003
osteosarcoma -1.179 0.004
cystic fibrosis 1.700 0.000
glioblastoma 1.700 0.002
primary pancreatic ductal adenocarcinoma 1.005 0.009
pediatric high grade glioma 1.100 0.000
Polycystic Ovary Syndrome 1.120 0.047
Breast cancer 1.300 0.000
ovarian cancer -1.700 0.000

Synonym

Accession Q9NR31 B4DQ19
Symbols SAR1
Sara
SARA1
masra2

Gene

PDB

2GAO  

Gene RIF (15)

PMID Text
26607390 SAR1A gene silencing in hepatocytes mimics the effect of ethanol: dedimerization of giantin, arresting PDIA3 in the endoplasmic reticulum (ER) and large-scale alterations in Golgi architecture.
24914133 Data indicate that hydroxyurea (HU) induces SAR1 protein expression, which in turn activates gamma-globin expression, predominantly through the Gialpha/JNK/Jun pathway.
24338480 although Sar1A antagonizes the lipoprotein secretion-promoting activity of Sar1B, both isoforms modulate the expression of genes encoding cholesterol biosynthetic enzymes and the synthesis of cholesterol de novo.
23019651 Sedlin bound and promoted efficient cycling of Sar1, a guanosine triphosphatase that can constrict membranes, and thus allowed nascent carriers to grow and incorporate procollagen prefibrils.
22974979 the behavior of the human of Sar1A and Sar1B, a key component of the COPII family of vesicle coat proteins, was examined.
22605651 Sar1 mutant proteins added to metaphase-arrested Xenopus laevis egg extracts cause dramatic effects on membrane organization.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20624903 lipid-directed and tether-assisted Sar1 organization controls membrane constriction to regulate ER export.
20457124 the intracellular trafficking of hCaR from the endoplasmic reticulum is Sar1-dependent via coat protein complex-II vesicles.
19357197 Kir6.2 contains a di-acidic endoplasmic reticulum exit signal, which promotes endoplasmic reticulum exit via a process that requires Sar1.
More...

AA Sequence

MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT      1 - 70
FTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNKIDRTD     71 - 140
AISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID                141 - 198
//

Text Mined References (37)

PMID Year Title
26607390 2015 Downregulation of the small GTPase SAR1A: a key event underlying alcohol-induced Golgi fragmentation in hepatocytes.
26522472 2015 Germline Heterozygous Variants in SEC23B Are Associated with Cowden Syndrome and Enriched in Apparently Sporadic Thyroid Cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24914133 2014 Hydroxyurea-inducible SAR1 gene acts through the Gi?/JNK/Jun pathway to regulate ?-globin expression.
24338480 2014 The endoplasmic reticulum coat protein II transport machinery coordinates cellular lipid secretion and cholesterol biosynthesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23019651 2012 Sedlin controls the ER export of procollagen by regulating the Sar1 cycle.
22974979 2012 Modulation of membrane rigidity by the human vesicle trafficking proteins Sar1A and Sar1B.
More...