Property Summary

NCBI Gene PubMed Count 39
PubMed Score 563.23
PubTator Score 31.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.477 3.2e-07
colon cancer 1.500 2.5e-05
dermatomyositis 1.300 1.1e-03
diabetes mellitus -1.300 2.4e-02
group 3 medulloblastoma 1.300 8.0e-05
juvenile dermatomyositis 1.062 1.1e-10
lung cancer 1.400 2.3e-02
medulloblastoma, large-cell 1.700 7.8e-05
Multiple myeloma 1.476 1.7e-03
non diabetic and post-ischemic heart fai... -1.200 1.1e-02
ovarian cancer 1.500 4.4e-04
primary Sjogren syndrome 1.100 3.5e-02
psoriasis 1.200 5.1e-04
ulcerative colitis 1.200 8.6e-06

Gene RIF (16)

AA Sequence

MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMN      1 - 70
SPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMN     71 - 140
GETREKSPKLKNGFPHPEPDCNPSEAASEESNSEIEQEIPVEQKEGAFSNFPISEETIKLLKGRGVTFLF    141 - 210
PIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDF    211 - 280
SDITKKLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFA    281 - 350
DQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHW    351 - 420
TQRAAVIGDVIRVYSGHQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGV    421 - 490
LVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKF    491 - 560
KRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEKLIEEKGAVEALAAALAHISGATSVDQRSLI    561 - 630
NSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDS    631 - 700
RRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQN    701 - 770
KGQKRSFSKAFGQ                                                             771 - 783
//

Text Mined References (58)

PMID Year Title