Property Summary

NCBI Gene PubMed Count 36
Grant Count 40
R01 Count 30
Funding $5,522,510.25
PubMed Score 545.13
PubTator Score 31.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.476 0.002
psoriasis 1.200 0.001
non diabetic and post-ischemic heart fai... -1.200 0.011
medulloblastoma, large-cell 1.700 0.000
juvenile dermatomyositis 1.062 0.000
acute quadriplegic myopathy 1.477 0.000
lung cancer 1.400 0.023
colon cancer 1.500 0.000
diabetes mellitus -1.300 0.024
group 3 medulloblastoma 1.300 0.000
primary Sjogren syndrome 1.100 0.035
ulcerative colitis 1.200 0.000
ovarian cancer 1.500 0.000
dermatomyositis 1.300 0.001

Gene RIF (18)

PMID Text
27033607 In dengue virus infected cells, DDX21 translocates from nucleus to cytoplasm to active the innate immune response and thus inhibits DENV replication in the early stages of infection.
25477391 Identification of several late-acting snoRNAs that bind pre-40S particles in human cells and show that their association and function in pre-40S complexes is regulated by the RNA helicase DDX21.
25470060 results uncover the multifaceted role of DDX21 in multiple steps of ribosome biogenesis, and provide evidence implicating a mammalian RNA helicase in RNA modification and Pol II elongation control
25260534 DDX21 expression in breast cancer cells can promote AP-1 activity and rRNA processing, and thus, promote tumorigenesis by two independent mechanisms.
24721576 As sequential interaction of PB1 and NS1 with DDX21 leads to temporal regulation of viral gene expression, influenza A virus likely uses the DDX21-NS1 interaction not only to overcome restriction, but also to regulate the viral life cycle.
23608157 DDX5 interacts with DDX21 and synergistically enhances the Rev function
23608157 DDX5 interacts with DDX21 and synergistically enhances the Rev function
23419719 Data indicate that DDX21, a nucleolar protein, was confirmed to associate with SET8.
23125841 DDX5 interacts with DDX21 and synergistically enhances the Rev function
23125841 DDX5 interacts with DDX21 and synergistically enhances the Rev function
More...

AA Sequence

MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMN      1 - 70
SPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMN     71 - 140
GETREKSPKLKNGFPHPEPDCNPSEAASEESNSEIEQEIPVEQKEGAFSNFPISEETIKLLKGRGVTFLF    141 - 210
PIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDF    211 - 280
SDITKKLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFA    281 - 350
DQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHW    351 - 420
TQRAAVIGDVIRVYSGHQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGV    421 - 490
LVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKF    491 - 560
KRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEKLIEEKGAVEALAAALAHISGATSVDQRSLI    561 - 630
NSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDS    631 - 700
RRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQN    701 - 770
KGQKRSFSKAFGQ                                                             771 - 783
//

Text Mined References (54)

PMID Year Title
27033607 2016 DDX21 translocates from nucleus to cytoplasm and stimulates the innate immune response due to dengue virus infection.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25477391 2015 The association of late-acting snoRNPs with human pre-ribosomal complexes requires the RNA helicase DDX21.
25470060 2015 RNA helicase DDX21 coordinates transcription and ribosomal RNA processing.
25416956 2014 A proteome-scale map of the human interactome network.
25260534 2014 Elevated DDX21 regulates c-Jun activity and rRNA processing in human breast cancers.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24721576 2014 Cellular DDX21 RNA helicase inhibits influenza A virus replication but is counteracted by the viral NS1 protein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23848194 2013 Nucleolar scaffold protein, WDR46, determines the granular compartmental localization of nucleolin and DDX21.
More...