Property Summary

NCBI Gene PubMed Count 163
Grant Count 260
R01 Count 158
Funding $36,756,263.84
PubMed Score 912.88
PubTator Score 519.52

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NR28 B2RDQ0 Q6W3F3 Q96LV0 Q9BT11 Q9HAV6
Symbols SMAC
DFNA64

Gene

PDB

1XB0   1XB1   3D9U   1G3F   1G73   3UIH   3UIJ   1OXQ   1TW6   1FEW   4TX5  

Gene RIF (121)

PMID Text
26575016 Report role of RIP1 in Smac mimetic mediated chemosensitization of neuroblastoma cells.
26567362 This review discusses the promise as well as some challenges at the translational interface of exploiting Smac mimetics as cancer therapeutics.
26134559 Data show that mitochondrial X-linked inhibitor of apoptosis protein (XIAP) entry requires apoptosis regulatory proteins Bax or Bak through mitochondrial permeabilization and Smac/DIABLO protein degradation.
25889084 SapC-DOPS acts through a mitochondria-mediated pathway accompanied by an early release of Smac and Bax.
25650938 Smac-DIABLO adopts a tetrameric assembly in solution.
25586349 this is the first demonstration that a dual approach using simultaneous overexpression of a cell penetrable form of Smac and TRAIL sensitize and promote apoptotic process even in resistant breast cancer cells.
25577253 Preoperative measurement of serum VEGF, survivin, and Smac/DIABLO may be of help in early detection of serous ovarian cancer and may provide important information about the patient's outcome and prognosis.
25549803 Data indicate that Smac/DIABLO showed an inverse correlation with inhibitor of apoptosis proteins XIAP, cIAP-1 and cIAP-2.
25501823 IRF1 is a dual regulator of BV6-induced apoptosis and inflammatory cytokine secretion.
25337193 Describe a new alternatively spliced isoform of Smac which promotes thr formation of mammospheres.
More...

AA Sequence

MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSS      1 - 70
EALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGAR     71 - 140
AEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAE    141 - 210
AQIEELRQKTQEEGEERAESEQEAYLRED                                             211 - 239
//

Text Mined References (167)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26575016 2015 Differential role of RIP1 in Smac mimetic-mediated chemosensitization of neuroblastoma cells.
26567362 2015 Promises and Challenges of Smac Mimetics as Cancer Therapeutics.
26134559 2015 Bax/Bak-dependent, Drp1-independent Targeting of X-linked Inhibitor of Apoptosis Protein (XIAP) into Inner Mitochondrial Compartments Counteracts Smac/DIABLO-dependent Effector Caspase Activation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25889084 2015 SapC-DOPS nanovesicles induce Smac- and Bax-dependent apoptosis through mitochondrial activation in neuroblastomas.
25650938 2015 The activator of apoptosis Smac-DIABLO acts as a tetramer in solution.
25586349 2015 Bypassing the need for pre-sensitization of cancer cells for anticancer TRAIL therapy with secretion of novel cell penetrable form of Smac from hA-MSCs as cellular delivery vehicle.
25577253 2015 Prognostic significance of pretreatment VEGF, survivin, and Smac/DIABLO serum levels in patients with serous ovarian carcinoma.
25549803 2015 Prognostic value of inhibitor of apoptosis protein family expression in patients with acute myeloid leukemia.
More...