Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.12
PubTator Score 3.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
cutaneous lupus erythematosus 1.800 0.001
osteosarcoma -1.435 0.001
ovarian cancer -1.300 0.002

Synonym

Accession Q9NR21 B4DRQ0 Q68DS1 Q8N5Y9 PARP-11
Symbols ARTD11
MIB006
C12orf6

Gene

PANTHER Protein Class (1)

PDB

2DK6  

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MFHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISF      1 - 70
TTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQT     71 - 140
HEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIH    141 - 210
NFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDY    211 - 280
INGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH                       281 - 331
//

Text Mined References (15)

PMID Year Title
25673562 2015 Spermatid head elongation with normal nuclear shaping requires ADP-ribosyltransferase PARP11 (ARTD11) in mice.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
23263487 2013 Genome-wide association analyses in East Asians identify new susceptibility loci for colorectal cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16541075 2006 The finished DNA sequence of human chromosome 12.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...