Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.12
PubTator Score 3.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 1.3e-06
osteosarcoma 7950 9.5e-04
cutaneous lupus erythematosus 1057 1.2e-03
ovarian cancer 8520 2.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Apraxia 26 3.732 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 1.800 1.2e-03
malignant mesothelioma 1.900 1.3e-06
osteosarcoma -1.435 9.5e-04
ovarian cancer -1.300 2.2e-03

Gene RIF (1)

AA Sequence

MFHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISF      1 - 70
TTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQT     71 - 140
HEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIH    141 - 210
NFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDY    211 - 280
INGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH                       281 - 331
//

Text Mined References (15)

PMID Year Title