Property Summary

Ligand Count 1
NCBI Gene PubMed Count 11
PubMed Score 2.55
PubTator Score 2.22

Knowledge Summary

Patent (4,353)

TINX Plot

  Disease (2)

Disease Target Count P-value
group 4 medulloblastoma 1855 4.5e-04
Disease Target Count Z-score Confidence
Down syndrome 499 3.95 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
group 4 medulloblastoma -1.400 4.5e-04

Gene RIF (2)

AA Sequence

MPASELKASEIPFHPSIKTQDPKAEEKSPKKQKVTLTAAEALKLFKNQLSPYEQSEILGYAELWFLGLEA      1 - 70
KKLDTAPEKFSKTSFDDEHGFYLKVLHDHIAYRYEVLETIGKGSFGQVAKCLDHKNNELVALKIIRNKKR     71 - 140
FHQQALMELKILEALRKKDKDNTYNVVHMKDFFYFRNHFCITFELLGINLYELMKNNNFQGFSLSIVRRF    141 - 210
TLSVLKCLQMLSVEKIIHCDLKPENIVLYQKGQASVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHP    211 - 280
YDVAIDMWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNN    281 - 350
RGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWIHQSRNLKPQPRPQTLRKSNS    351 - 420
FFPSETRKDKVQGCHHSSRKADEITKETTEKTKDSPTKHVQHSGDQQDCLQHGADTVQLPQLVDAPKKSE    421 - 490
AAVGAEVSMTSPGQSKNFSLKNTNVLPPIV                                            491 - 520
//

Text Mined References (14)

PMID Year Title