Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.38
PubTator Score 2.22

Knowledge Summary

Patent (4,353)


  Disease Sources (2)

Disease Target Count P-value
group 4 medulloblastoma 1875 4.49233379829877E-4
Disease Target Count Z-score Confidence
Down syndrome 548 3.947 2.0


  Differential Expression (1)

Disease log2 FC p
group 4 medulloblastoma -1.400 0.000


Accession Q9NR20 A8K8F7 Q8NEF2 Q92631


  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

Pathway (1)

Gene RIF (2)

21127067 DYRK4 isoforms resulting from alternative splicing differ in subcellular localization and catalytic activity
17292540 Dyrk4 is a testis-specific kinase with a very restricted expression to stage VIII postmeiotic spermatids.

AA Sequence

AAVGAEVSMTSPGQSKNFSLKNTNVLPPIV                                            491 - 520

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
21127067 2011 Splice variants of the dual specificity tyrosine phosphorylation-regulated kinase 4 (DYRK4) differ in their subcellular localization and catalytic activity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17292540 2007 The expression of the testis-specific Dyrk4 kinase is highly restricted to step 8 spermatids but is not required for male fertility in mice.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15607427 2005 DYRK gene structure and erythroid-restricted features of DYRK3 gene expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).