Property Summary

NCBI Gene PubMed Count 20
PubMed Score 163.23
PubTator Score 49.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ulcerative colitis 2087 2.14084775124925E-5
ductal carcinoma in situ 1745 0.00105167863280715
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00126169206961774
invasive ductal carcinoma 2950 0.00187256772138342
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00529142328666937
fibroadenoma 557 0.0224054054343534
Disease Target Count Z-score Confidence
Cystoisosporiasis 3 4.33 2.2

Expression

Synonym

Accession Q9NR19 A6NE90 Q5QPH2 Q5QPH3 Q8N238 Q96EL0 Q9NQP7 Q9UJ15
Symbols ACS
ACSA
ACAS2
ACECS
dJ1161H23.1

Gene

PANTHER Protein Class (2)

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (12)

PMID Text
26381042 Loss of ACSS2 expression is associated with with gastric cancer.
25584894 Study revealed that the activity of acetyl-CoA synthetase 2 (ACSS2) contributes to cancer cell growth under low-oxygen and lipid-depleted conditions.
25525878 Study shows that ACSS2 is upregulated in the human orthotopic tumor and primary human tumors, as well as a murine glioma model; the tumors do not oxidize [U-(13)C]glutamine. In vivo oxidation of [1,2-(13)C]acetate was validated in brain tumor patients and was correlated with expression of acetyl-CoA synthetase enzyme 2, ACSS2.
25525877 Observations suggest that ACSS2 is expressed to a significant extent in particular tumor types, including triple-negative breast cancers.
25108527 During hypoxia, ACSS2 modulates interactions of the acetylase/coactivator CBP with the stress-responsive transcription factor, HIF-2. These interactions include acetylation of HIF-2 by CBP as well as stable HIF-2/CBP complex formation, both of which are required for maximal HIF-2 signaling. Thus, ACSS2 links changes in metabolism that occur during stress with activation of a selective nuclear signaling pathway.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20353815 Ritonavir (at 100 mg once daily and 100 mg twice daily significantly down-regulated acyl-CoA synthetase short-chain family member 2 in 20 healthy individuals.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19617323 The patterns of (18)F-FDG and (11)C-acetate uptake seemed to complement each other in both human HCC and HCC cell lines.
More...

AA Sequence

MGLPEERVRSGSGSRGQEEAGAGGRARSWSPPPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFY      1 - 70
WKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQ     71 - 140
LLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSL    141 - 210
LITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQIS    211 - 280
WNQGIDLWWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAE    281 - 350
DVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKFG    351 - 420
DEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSAT    421 - 490
FPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQDG    491 - 560
YYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPKLTEE    561 - 630
LKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDMSTVADPSVISHLFSHRCLTI    631 - 700
Q//

Text Mined References (28)

PMID Year Title
26381042 2015 Loss of ACSS2 expression predicts poor prognosis in patients with gastric cancer.
25584894 2015 Acetyl-CoA synthetase 2 promotes acetate utilization and maintains cancer cell growth under metabolic stress.
25525878 2014 Acetate is a bioenergetic substrate for human glioblastoma and brain metastases.
25525877 2014 Acetate dependence of tumors.
25108527 2014 An acetate switch regulates stress erythropoiesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
More...