Property Summary

NCBI Gene PubMed Count 42
Grant Count 156
R01 Count 87
Funding $23,689,226.62
PubMed Score 225.53
PubTator Score 1108.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis -1.700 0.020
interstitial lung disease 1.100 0.004
psoriasis -2.300 0.000
osteosarcoma -1.641 0.005
atypical teratoid / rhabdoid tumor 2.200 0.000
glioblastoma 1.600 0.008
primary pancreatic ductal adenocarcinoma 1.608 0.007
colon cancer -1.500 0.002
pediatric high grade glioma 1.100 0.009
COPD -1.300 0.002
Polycystic Ovary Syndrome -1.011 0.005
gastric carcinoma 1.700 0.030
Gaucher disease type 3 1.100 0.036
chronic rhinosinusitis 1.069 0.014
pancreatic cancer 1.800 0.007
dermatomyositis -1.500 0.015

Synonym

Accession Q9NR12 Q14250 Q5XG82 Q6NVZ5 Q96C91 Q9BXB8 Q9BXB9
Symbols LMP1
LMP3

Gene

PDB

2Q3G  

Gene RIF (26)

PMID Text
25760809 The results showed that LMP-1 inhibited cell apoptosis and induced survivin expression in nasal natural killer/T-cell lymphoma
25641592 The results suggest local transduction with LMP-1 gene promotes osteogenesis and mineralization in distraction osteogenesis.
25336289 LMP-1 mRNA level was regulated in a dose-dependent manner after transfection
25124035 These results are consistent with a model in which binding of OspE to PDLIM7 during infection regulates the activity of PKC isoforms that bind to the PDLIM7 LIM domain.
24762763 LMP1 expression suppressed the expression of Runx2 and BMP-2 in OS cells.
24466333 High Enigma expression is associated with breast neoplasms.
24078030 A direct interaction of Jab1 with LMP-1, is reported.
23097599 LMP3 induced the successful osteogenic differentiation of AFSC by inducing the expression of osteogenic markers and osteospecific transcription factors.
22982077 Molecular basis of the overactive osteogenic process may at least in part involve a deregulation of the LMP-related pathway in calvarial cells.
22417000 findings indicate the existence of a new cell cycle-associated signaling pathway in which LMP1 regulates ERK-mediated Op18/stathmin signaling
More...

AA Sequence

MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQNKI      1 - 70
RACGERLSLGLSRAQPVQSKPQKASAPAADPPRYTFAPSVSLNKTARPFGAPPPADSAPQQNGQPLRPLV     71 - 140
PDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPW    141 - 210
PGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATPTPLQSRTSIVQAAAGGVPGGGSNNGKTP    211 - 280
VCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITG    281 - 350
EIMHALKMTWHVHCFTCAACKTPIRNRAFYMEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFS    351 - 420
WHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSHV                                     421 - 457
//

Text Mined References (50)

PMID Year Title
25760809 2015 LMP-1 induces survivin expression to inhibit cell apoptosis through the NF-?B and PI3K/Akt signaling pathways in nasal NK/T-cell lymphoma.
25641592 2015 Osteogenesis and mineralization in a rabbit mandibular distraction osteogenesis model is promoted by the human LMP-1 gene.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25336289 2015 LIM mineralization protein-1 suppresses TNF-? induced intervertebral disc degeneration by maintaining nucleus pulposus extracellular matrix production and inhibiting matrix metalloproteinases expression.
25124035 2014 Systematic analysis of bacterial effector-postsynaptic density 95/disc large/zonula occludens-1 (PDZ) domain interactions demonstrates Shigella OspE protein promotes protein kinase C activation via PDLIM proteins.
24762763 2014 LIM mineralization protein-1 inhibits the malignant phenotypes of human osteosarcoma cells.
24466333 2014 Enigma prevents Cbl-c-mediated ubiquitination and degradation of RETMEN2A.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
More...