Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.50732254105463E-9
posterior fossa group B ependymoma 1530 8.41753541723097E-9
psoriasis 6685 1.51756775153966E-7
medulloblastoma, large-cell 6234 3.21460164858465E-4
adrenocortical carcinoma 1427 4.18551178473702E-4
pediatric high grade glioma 2712 0.00113951160692293
glioblastoma 5572 0.00143762635878335
primitive neuroectodermal tumor 3031 0.0015443033477884
Pick disease 1893 0.00217927760464825
gastric cancer 436 0.00284243284301588
osteosarcoma 7933 0.0041562932893657
sarcoidosis 368 0.00424729578852967
atypical teratoid / rhabdoid tumor 4369 0.00500528131067747
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00622622747620571
progressive supranuclear palsy 674 0.0101674218973994
astrocytic glioma 2241 0.0297867222849032
active ulcerative colitis 477 0.0426817174136621
Disease Target Count Z-score Confidence
Hypospadias 65 3.608 1.8

Expression

  Differential Expression (17)

Synonym

Accession Q9NR11 Q658J3 Q9BZD8 Q9P0J4
Symbols HSD16
MST154
ZNF327
MSTP154
ZNF135L
ZNF140L

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

AA Sequence

MSQVTFSDVAIDFSHEEWACLDSAQRDLYKDVMVQNYENLVSVGLSVTKPYVIMLLEDGKEPWMMEKKLS      1 - 70
KAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNSPNSTVEAFSRSKKKKKKKKK     71 - 140
RQCFAFLIYFRLGIKMGKQGIINKEGYLYEDSPQPVTMEKVVKQSYEFSNSNKNLEYTECDTFRSTFHSK    141 - 210
STLSEPQNNSAEGNSHKYDILKKNLSKKSVIKSERINGGKKLLNSNKSGAAFNQSKSLTLPQTCNREKIY    211 - 280
TCSECGKAFGKQSILSRHWRIHTGEKPYECRECGKTFSHGSSLTRHQISHSGEKPYKCIECGKAFSHGSS    281 - 350
LTNHQSTHTGEKPYECMNCGKSFSRVSLLIQHLRIHTQEKRYECRICGKAFIHSSSLIHHQKSHTGEKPY    351 - 420
ECRECGKAFCCSSHLTQHQRIHSMKKKYECNKCLKVFSSFSFLVQHQSIHTEEKPFEV                421 - 478
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7865130 1995 Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937.