Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis -1.064 4.3e-02
adrenocortical carcinoma 1.250 4.2e-04
astrocytic glioma 1.600 3.0e-02
atypical teratoid / rhabdoid tumor -1.300 5.0e-03
ependymoma -1.400 8.0e-09
gastric cancer 1.100 2.8e-03
glioblastoma -1.600 1.4e-03
intraductal papillary-mucinous carcinoma... 1.200 6.2e-03
medulloblastoma, large-cell -1.600 3.2e-04
osteosarcoma -1.401 4.2e-03
ovarian cancer -1.800 2.9e-06
pediatric high grade glioma -1.200 1.1e-03
Pick disease -1.100 2.2e-03
primitive neuroectodermal tumor 1.400 1.5e-03
progressive supranuclear palsy -1.500 1.0e-02
psoriasis -1.600 1.5e-07
sarcoidosis 1.100 4.2e-03

AA Sequence

MSQVTFSDVAIDFSHEEWACLDSAQRDLYKDVMVQNYENLVSVGLSVTKPYVIMLLEDGKEPWMMEKKLS      1 - 70
KAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNSPNSTVEAFSRSKKKKKKKKK     71 - 140
RQCFAFLIYFRLGIKMGKQGIINKEGYLYEDSPQPVTMEKVVKQSYEFSNSNKNLEYTECDTFRSTFHSK    141 - 210
STLSEPQNNSAEGNSHKYDILKKNLSKKSVIKSERINGGKKLLNSNKSGAAFNQSKSLTLPQTCNREKIY    211 - 280
TCSECGKAFGKQSILSRHWRIHTGEKPYECRECGKTFSHGSSLTRHQISHSGEKPYKCIECGKAFSHGSS    281 - 350
LTNHQSTHTGEKPYECMNCGKSFSRVSLLIQHLRIHTQEKRYECRICGKAFIHSSSLIHHQKSHTGEKPY    351 - 420
ECRECGKAFCCSSHLTQHQRIHSMKKKYECNKCLKVFSSFSFLVQHQSIHTEEKPFEV                421 - 478
//

Text Mined References (8)

PMID Year Title