Property Summary

NCBI Gene PubMed Count 24
PubMed Score 9.80
PubTator Score 44.96

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 3.88870209313645E-20
non-small cell lung cancer 2798 8.01046059624166E-12
psoriasis 6685 4.70660392371574E-8
lung cancer 4473 5.36800037315375E-6
ulcerative colitis 2087 6.78992351967937E-6
inflammatory breast cancer 404 1.65453076607634E-4
pituitary cancer 1972 2.66969576430176E-4
astrocytoma 1493 5.18549309050112E-4
glioblastoma 5572 0.00107858343597085
ovarian cancer 8492 0.00122435423224929
group 4 medulloblastoma 1875 0.00211651091494191
adrenocortical adenoma 134 0.00647229230073753
medulloblastoma, large-cell 6234 0.00744772203569785
atypical teratoid / rhabdoid tumor 4369 0.0105741341867802
cutaneous lupus erythematosus 1056 0.0133625154420586
aldosterone-producing adenoma 664 0.020176280399406
oligodendroglioma 2849 0.0210011168452047
esophageal adenocarcinoma 737 0.0277606828034737
Barrett's esophagus 185 0.0333610630065008
gastric carcinoma 832 0.0409333569001315
colon cancer 1475 0.0411285805574512
ductal carcinoma in situ 1745 0.0414051657186644
adrenocortical carcinoma 1427 0.0490782356291517
Disease Target Count Z-score Confidence
Thyroid cancer 25 3.124 1.6


  Differential Expression (23)

Disease log2 FC p
oligodendroglioma -1.700 0.021
Barrett's esophagus 1.900 0.033
esophageal adenocarcinoma 1.600 0.028
cutaneous lupus erythematosus 1.300 0.013
astrocytoma 1.100 0.001
glioblastoma 3.800 0.001
group 4 medulloblastoma -2.300 0.002
atypical teratoid / rhabdoid tumor -1.500 0.011
medulloblastoma, large-cell -2.300 0.007
adrenocortical adenoma -1.211 0.006
adrenocortical carcinoma -1.262 0.049
non-small cell lung cancer -1.898 0.000
lung cancer -3.400 0.000
colon cancer -2.200 0.041
aldosterone-producing adenoma -1.357 0.020
psoriasis -2.100 0.000
inflammatory breast cancer -2.800 0.000
lung carcinoma -2.600 0.000
gastric carcinoma 1.300 0.041
ductal carcinoma in situ 2.000 0.041
ulcerative colitis 2.800 0.000
ovarian cancer 3.000 0.001
pituitary cancer -1.500 0.000


Accession Q9NR00
Symbols TC1


 GO Function (1)

Gene RIF (16)

26744410 Decreased capacity of fibrotic lung fibroblasts to up-regulate COX-2 expression and COX-2-derived PGE2 synthesis is due to an indirect epigenetic mechanism involving hypermethylation of the transcriptional regulator, c8orf4.
25985737 C8orf4 negatively regulates the self-renewal of liver CSCs via suppression of NOTCH2 signalling
25869879 the high expression of TC1 was common in oral tongue squamous cell carcinomas and correlated with the expression of b-catenin and cyclin D1 and the progression of oral tongue squamous cell carcinomas
24941347 TC-1 overexpression promotes cell proliferation in human non-small cell lung cancer that can be inhibited by PD173074.
23880650 TC-1 expression is associated with aggressive biologic behavior in lung cancer and might coordinate with the Wnt/beta-catenin pathway as a positive upstream regulator that induces these behaviors.
23377761 The higher expression of TC-1 in ovarian compared to colorectal adenocarcinomas suggests its potential use as a marker
22658654 The SNP rs10958605 in the C8orf4 gene had the smallest p value in analyses of the motor outcome.
20878554 A significant association was found between the copy-number deletions of C8orf4 and the risk of hematological malignancies.
18959821 TC1 was involved in the mitogen-activated ERK1/2 signaling pathway and positively regulated G(1)- to S-phase transition of the cell cycle.
17905836 intrinsically disordered TC-1 interacts with Cby via its transient helical structure

AA Sequence

DQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH                                       71 - 106

Text Mined References (26)

PMID Year Title
26744410 2016 Epigenetic regulation of cyclooxygenase-2 by methylation of c8orf4 in pulmonary fibrosis.
25985737 2015 C8orf4 negatively regulates self-renewal of liver cancer stem cells via suppression of NOTCH2 signalling.
25869879 2015 The high expression of TC1 (C8orf4) was correlated with the expression of ?-catenin and cyclin D1 and the progression of squamous cell carcinomas of the tongue.
24941347 2014 TC-1 overexpression promotes cell proliferation in human non-small cell lung cancer that can be inhibited by PD173074.
24937306 2014 TC1(C8orf4) regulates hematopoietic stem/progenitor cells and hematopoiesis.
23880650 2013 TC-1 (c8orf4) enhances aggressive biologic behavior in lung cancer through the Wnt/?-catenin pathway.
23377761 2013 TC-1 (C8orf4) expression is correlated with differentiation in ovarian carcinomas and might distinguish metastatic ovarian from metastatic colorectal carcinomas.
22658654 2012 Genomic determinants of motor and cognitive outcomes in Parkinson's disease.
20878554 2011 Investigation of copy-number variations of C8orf4 in hematological malignancies.
19684084 2009 TC1(C8orf4) is a novel endothelial inflammatory regulator enhancing NF-kappaB activity.