Property Summary

NCBI Gene PubMed Count 24
PubMed Score 11.57
PubTator Score 44.96

Knowledge Summary


No data available


  Differential Expression (23)

Disease log2 FC p
adrenocortical adenoma -1.211 6.5e-03
adrenocortical carcinoma -1.262 4.9e-02
aldosterone-producing adenoma -1.357 2.0e-02
astrocytoma 1.100 5.2e-04
atypical teratoid / rhabdoid tumor -1.500 1.1e-02
Barrett's esophagus 1.900 3.3e-02
colon cancer -2.200 4.1e-02
cutaneous lupus erythematosus 1.300 1.3e-02
ductal carcinoma in situ 2.000 4.1e-02
esophageal adenocarcinoma 1.600 2.8e-02
gastric carcinoma 1.300 4.1e-02
glioblastoma 1.400 2.0e-02
group 4 medulloblastoma -2.300 2.1e-03
inflammatory breast cancer -2.600 3.3e-05
lung cancer -3.400 5.4e-06
lung carcinoma -2.600 3.9e-20
medulloblastoma, large-cell -2.300 7.4e-03
non-small cell lung cancer -1.898 8.0e-12
oligodendroglioma -1.700 2.1e-02
ovarian cancer 3.000 1.2e-03
pituitary cancer -1.500 2.7e-04
psoriasis -2.100 4.7e-08
ulcerative colitis 2.800 6.8e-06

 GO Function (1)

Gene RIF (16)

AA Sequence

DQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH                                       71 - 106

Text Mined References (26)

PMID Year Title