Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.25
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.700 9.3e-07
atypical teratoid / rhabdoid tumor 1.100 4.3e-06
medulloblastoma, large-cell 1.300 4.1e-04
lung cancer 1.300 3.8e-03
group 4 medulloblastoma 1.400 5.6e-05
psoriasis 1.500 2.1e-117

Gene RIF (1)

PMID Text
20534741 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MARISFSYLCPASWYFTVPTVSPFLRQRVAFLGLFFISCLLLLMLIIDFRHWSASLPRDRQYERYLARVG      1 - 70
ELEATDTEDPNLNYGLVVDCGSSGSRIFVYFWPRHNGNPHDLLDIKQMRDRNSQPVVKKIKPGISAMADT     71 - 140
PEHASDYLRPLLSFAAAHVPVKKHKETPLYILCTAGMRLLPERKQLAILADLVKDLPLEFDFLFSQSQAE    141 - 210
VISGKQEGVYAWIGINFVLGRFDHEDESDAEATQELAAGRRRTVGILDMGGASLQIAYEVPTSTSVLPAK    211 - 280
QEEAAKILLAEFNLGCDVQHTEHVYRVYVTTFLGFGGNFARQRYEDLVLNETLNKNRLLGQKTGLSPDNP    281 - 350
FLDPCLPVGLTDVVERNSQVLHVRGRGDWVSCGAMLSPLLARSNTSQASLNGIYQSPIDFNNSEFYGFSE    351 - 420
FFYCTEDVLRIGGRYHGPTFAKAAQDYCGMAWSVLTQRFKNGLFSSHADEHRLKYQCFKSAWMYQVLHEG    421 - 490
FHFPYDYPNLRTAQLVYDREVQWTLGAILYKTRFLPLRDLRQEGVRQAHGSWFRLSFVYNHYLFFACILV    491 - 560
VLLAIFLYLLRLRRIHHRQTRASAPLDLLWLEEVVPMMGVQVGP                              561 - 604
//

Text Mined References (7)

PMID Year Title
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278936 2001 Molecular cloning and characterization of a novel mammalian endo-apyrase (LALP1).