Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.25
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.3e-06
group 4 medulloblastoma 1.400 5.6e-05
lung cancer 1.300 3.8e-03
malignant mesothelioma -1.700 9.3e-07
medulloblastoma, large-cell 1.300 4.1e-04
psoriasis 1.500 2.1e-117

Gene RIF (1)

AA Sequence

MARISFSYLCPASWYFTVPTVSPFLRQRVAFLGLFFISCLLLLMLIIDFRHWSASLPRDRQYERYLARVG      1 - 70
ELEATDTEDPNLNYGLVVDCGSSGSRIFVYFWPRHNGNPHDLLDIKQMRDRNSQPVVKKIKPGISAMADT     71 - 140
PEHASDYLRPLLSFAAAHVPVKKHKETPLYILCTAGMRLLPERKQLAILADLVKDLPLEFDFLFSQSQAE    141 - 210
VISGKQEGVYAWIGINFVLGRFDHEDESDAEATQELAAGRRRTVGILDMGGASLQIAYEVPTSTSVLPAK    211 - 280
QEEAAKILLAEFNLGCDVQHTEHVYRVYVTTFLGFGGNFARQRYEDLVLNETLNKNRLLGQKTGLSPDNP    281 - 350
FLDPCLPVGLTDVVERNSQVLHVRGRGDWVSCGAMLSPLLARSNTSQASLNGIYQSPIDFNNSEFYGFSE    351 - 420
FFYCTEDVLRIGGRYHGPTFAKAAQDYCGMAWSVLTQRFKNGLFSSHADEHRLKYQCFKSAWMYQVLHEG    421 - 490
FHFPYDYPNLRTAQLVYDREVQWTLGAILYKTRFLPLRDLRQEGVRQAHGSWFRLSFVYNHYLFFACILV    491 - 560
VLLAIFLYLLRLRRIHHRQTRASAPLDLLWLEEVVPMMGVQVGP                              561 - 604
//

Text Mined References (14)

PMID Year Title