Property Summary

NCBI Gene PubMed Count 18
PubMed Score 47.46
PubTator Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.100 0.000
non-inflammatory breast cancer -1.400 0.001

Synonym

Accession Q9NQZ6 B2RDC2 B3KVZ5 B4DED0 E7EM74 G3V1L3 Q53H73 Q5JTF9 Q9H9C3 Q9H9H7 Q9ULQ4
Symbols WWS
WRWF
HCA127
KIAA1166

Gene

Gene RIF (2)

PMID Text
26056227 ZC4H2, an XLID gene, is required for the generation of a specific subset of CNS interneurons
23623388 ZC4H2 mutations are associated with arthrogryposis multiplex congenita and intellectual disability through impairment of central and peripheral synaptic plasticity.

AA Sequence

MADEQEIMCKLESIKEIRNKTLQMEKIKARLKAEFEALESEERHLKEYKQEMDLLLQEKMAHVEELRLIH      1 - 70
ADINVMENTIKQSENDLNKLLESTRRLHDEYKPLKEHVDALRMTLGLQRLPDLCEEEEKLSLDYFEKQKA     71 - 140
EWQTEPQEPPIPESLAAAAAAAQQLQVARKQDTRQTATFRQQPPPMKACLSCHQQIHRNAPICPLCKAKS    141 - 210
RSRNPKKPKRKQDE                                                            211 - 224
//

Text Mined References (18)

PMID Year Title
26056227 2015 ZC4H2, an XLID gene, is required for the generation of a specific subset of CNS interneurons.
25416956 2014 A proteome-scale map of the human interactome network.
23623388 2013 ZC4H2 mutations are associated with arthrogryposis multiplex congenita and intellectual disability through impairment of central and peripheral synaptic plasticity.
21668950 2011 A computational approach to candidate gene prioritization for X-linked mental retardation using annotation-based binary filtering and motif-based linear discriminatory analysis.
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
19132878 2009 Zinc fingers as biologic redox switches?
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17210253 2007 Sticky fingers: zinc-fingers as protein-recognition motifs.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...