Property Summary

NCBI Gene PubMed Count 20
PubMed Score 15.47
PubTator Score 6.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
juvenile dermatomyositis 1187 3.5e-12
ovarian cancer 8520 1.1e-04
diabetes mellitus 1728 3.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Choledocholithiasis 11 4.181 2.1
Gingivitis 29 3.129 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.400 3.2e-03
juvenile dermatomyositis 1.031 3.5e-12
ovarian cancer -1.100 1.1e-04

 GO Function (1)

Gene RIF (2)

AA Sequence

MVGRSRRRGAAKWAAVRAKAGPTLTDENGDDLGLPPSPGDTSYYQDQVDDFHEARSRAALAKGWNEVQSG      1 - 70
DEEDGEEEEEEVLALDMDDEDDEDGGNAGEEEEEENADDDGGSSVQSEAEASVDPSLSWGQRKKLYYDTD     71 - 140
YGSKSRGRQSQQEAEEEEREEEEEAQIIQRRLAQALQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKV    141 - 210
SVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQYLRTKYNLYLNYCSNIS    211 - 280
FYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPKPKS    281 - 350
VSKTSAAACAVTDLSDDSDFDEKAKLKYYKEIEDRQKLKRKKEENSTEEQALEDQNAKRAITYQIAKNRG    351 - 420
LTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRKEEQRYSGELSGIRAGVKKSIKLK               421 - 479
//

Text Mined References (28)

PMID Year Title