Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $543,182
PubMed Score 56.23
PubTator Score 6.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.100 0.001
osteosarcoma 2.644 0.000
intraductal papillary-mucinous adenoma (... 1.400 0.001

Gene RIF (2)

PMID Text
11274158 like RVS161, hob3+ and BIN3 regulate F-actin localization, but other roles for these genes have diverged somewhat during evolution
11274158 BIN3 is a BAR domain adapter protein implicated in actin regulation; it is homologous to budding yeast Rvs161 and fission yeast Hob3.

AA Sequence

MSWIPFKIGQPKKQIVPKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAVKISLDLLSNP      1 - 70
LCEQDQDLLNMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSVFPSLNMAVKRREQALQDYRRLQA     71 - 140
KVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNRQLLEEMPRFYGSRLDYFQPSFESLIRAQVVYYS    141 - 210
EMHKIFGDLSHQLDQPGHSDEQRERENEAKLSELRALSIVADD                               211 - 253
//

Text Mined References (12)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18654987 2008 Identification of multi-SH3 domain-containing protein interactome in pancreatic cancer: a yeast two-hybrid approach.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16524918 2006 The BAR domain proteins: molding membranes in fission, fusion, and phagy.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14993925 2004 The BAR-domain family of proteins: a case of bending and binding?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...