Property Summary

NCBI Gene PubMed Count 10
PubMed Score 56.86
PubTator Score 6.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.2e-07
intraductal papillary-mucinous adenoma (IPMA) 2955 1.0e-03
psoriasis 6694 1.2e-03
Disease Target Count Z-score Confidence
Ornithosis 9 4.583 2.3

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.400 1.0e-03
osteosarcoma 2.644 3.2e-07
psoriasis -1.100 1.2e-03

Protein-protein Interaction (11)

Gene RIF (2)

AA Sequence

MSWIPFKIGQPKKQIVPKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAVKISLDLLSNP      1 - 70
LCEQDQDLLNMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSVFPSLNMAVKRREQALQDYRRLQA     71 - 140
KVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNRQLLEEMPRFYGSRLDYFQPSFESLIRAQVVYYS    141 - 210
EMHKIFGDLSHQLDQPGHSDEQRERENEAKLSELRALSIVADD                               211 - 253
//

Text Mined References (12)

PMID Year Title