Property Summary

NCBI Gene PubMed Count 29
PubMed Score 40.78
PubTator Score 28.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.900 4.1e-03
chronic kidney disease 1.100 4.3e-02
chronic lymphosyte leukemia -1.100 5.3e-09
colon cancer -2.100 7.2e-04
group 3 medulloblastoma -1.800 2.9e-04
lung cancer 2.000 7.5e-04
lung carcinoma 1.400 1.2e-13
medulloblastoma, large-cell -2.800 2.0e-05
ovarian cancer 1.400 6.2e-05
periodontitis 1.200 1.7e-23
pituitary cancer -1.400 2.1e-03
primitive neuroectodermal tumor -1.200 1.2e-02

Gene RIF (2)

AA Sequence

MVKISFQPAVAGIKGDKADKASASAPAPASATEILLTPAREEQPPQHRSKRGGSVGGVCYLSMGMVVLLM      1 - 70
GLVFASVYIYRYFFLAQLARDNFFRCGVLYEDSLSSQVRTQMELEEDVKIYLDENYERINVPVPQFGGGD     71 - 140
PADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFWELLMNVKRGTYLPQTYIIQEEMVVTEHVSD    141 - 210
KEALGSFIYHLCNGKDTYRLRRRATRRRINKRGAKNCNAIRHFENTFVVETLICGVV                 211 - 267
//

Text Mined References (31)

PMID Year Title