Property Summary

NCBI Gene PubMed Count 29
PubMed Score 33.32
PubTator Score 28.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
periodontitis 269 1.70456296217504E-23
lung carcinoma 2844 1.21502509000295E-13
chronic lymphosyte leukemia 232 5.29326949131408E-9
medulloblastoma, large-cell 6234 1.98521911428068E-5
ovarian cancer 8492 6.22462117839382E-5
sonic hedgehog group medulloblastoma 1482 1.3611564580873E-4
colon cancer 1475 7.18864156887234E-4
lung cancer 4473 7.48289644304295E-4
pituitary cancer 1972 0.00212457307476155
atypical teratoid / rhabdoid tumor 4369 0.00406836044745552
primitive neuroectodermal tumor 3031 0.0120796767539409
chronic kidney disease 90 0.0431410194830774
Disease Target Count Z-score Confidence
Ossifying fibroma 13 3.113 1.6

Expression

  Differential Expression (12)

Disease log2 FC p
chronic lymphosyte leukemia -1.100 0.000
sonic hedgehog group medulloblastoma -2.300 0.000
periodontitis 1.200 0.000
atypical teratoid / rhabdoid tumor -1.900 0.004
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -1.200 0.012
chronic kidney disease 1.100 0.043
lung cancer 2.000 0.001
colon cancer -2.100 0.001
lung carcinoma 1.400 0.000
ovarian cancer 1.400 0.000
pituitary cancer -1.400 0.002

Synonym

Accession Q9NQX7 B3KPG4 Q4G0A8 Q53H84 Q6IAE7 Q86VK5 Q8N288 Q8TAW0 Q9BUP8
Symbols E25
BRI3
E25C
ITM3
BRICD2C

Gene

  Ortholog (10)

 MGI Term (1)

Pathway (1)

Gene RIF (2)

PMID Text
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVKISFQPAVAGIKGDKADKASASAPAPASATEILLTPAREEQPPQHRSKRGGSVGGVCYLSMGMVVLLM      1 - 70
GLVFASVYIYRYFFLAQLARDNFFRCGVLYEDSLSSQVRTQMELEEDVKIYLDENYERINVPVPQFGGGD     71 - 140
PADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFWELLMNVKRGTYLPQTYIIQEEMVVTEHVSD    141 - 210
KEALGSFIYHLCNGKDTYRLRRRATRRRINKRGAKNCNAIRHFENTFVVETLICGVV                 211 - 267
//

Text Mined References (31)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19849849 2009 CD74 interacts with APP and suppresses the production of Abeta.
19366692 2009 BRI3 inhibits amyloid precursor protein processing in a mechanistically distinct manner from its homologue dementia gene BRI2.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19114711 2009 Substrate requirements for SPPL2b-dependent regulated intramembrane proteolysis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18452648 2008 BRI3 associates with SCG10 and attenuates NGF-induced neurite outgrowth in PC12 cells.
More...