Property Summary

NCBI Gene PubMed Count 29
Grant Count 28
R01 Count 13
Funding $7,213,650.35
PubMed Score 33.32
PubTator Score 28.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
chronic lymphosyte leukemia -1.100 0.000
sonic hedgehog group medulloblastoma -2.300 0.000
periodontitis 1.200 0.000
atypical teratoid / rhabdoid tumor -1.900 0.004
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -1.200 0.012
chronic kidney disease 1.100 0.043
lung cancer 2.000 0.001
colon cancer -2.100 0.001
lung carcinoma 1.400 0.000
ovarian cancer 1.400 0.000
pituitary cancer -1.400 0.002

Gene RIF (2)

PMID Text
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVKISFQPAVAGIKGDKADKASASAPAPASATEILLTPAREEQPPQHRSKRGGSVGGVCYLSMGMVVLLM      1 - 70
GLVFASVYIYRYFFLAQLARDNFFRCGVLYEDSLSSQVRTQMELEEDVKIYLDENYERINVPVPQFGGGD     71 - 140
PADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFWELLMNVKRGTYLPQTYIIQEEMVVTEHVSD    141 - 210
KEALGSFIYHLCNGKDTYRLRRRATRRRINKRGAKNCNAIRHFENTFVVETLICGVV                 211 - 267
//

Text Mined References (31)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19849849 2009 CD74 interacts with APP and suppresses the production of Abeta.
19366692 2009 BRI3 inhibits amyloid precursor protein processing in a mechanistically distinct manner from its homologue dementia gene BRI2.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19114711 2009 Substrate requirements for SPPL2b-dependent regulated intramembrane proteolysis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18452648 2008 BRI3 associates with SCG10 and attenuates NGF-induced neurite outgrowth in PC12 cells.
More...