Property Summary

NCBI Gene PubMed Count 13
Grant Count 24
R01 Count 19
Funding $2,727,707.68
PubMed Score 15.06
PubTator Score 475.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Spinocerebellar ataxia type 1 16 3.414 1.7

Expression

Gene RIF (2)

PMID Text
15563841 Human gene mapped to chromosome 9q34.3.
15229225 NPDC-1 has a role in regulating neuronal proliferation and is degraded by the ubiquitin/proteasome system through a PEST degradation motif

AA Sequence

MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPF      1 - 70
QEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGL     71 - 140
ELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQ    141 - 210
REIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEEN    211 - 280
EDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP                             281 - 325
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15563841 2004 Functional analysis of the NPDC-1 gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15229225 2004 NPDC-1, a novel regulator of neuronal proliferation, is degraded by the ubiquitin/proteasome system through a PEST degradation motif.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...