Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.06
PubTator Score 475.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 1 16 3.437 1.7

Expression

Synonym

Accession Q9NQX5 Q5SPY8 Q9BTD6 Q9BXT3 Q9NQS2 Q9Y434 NPDC-1
Symbols CAB
CAB-
CAB1
CAB-1
NPDC-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPF      1 - 70
QEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGL     71 - 140
ELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQ    141 - 210
REIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEEN    211 - 280
EDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP                             281 - 325
//

Text Mined References (17)

PMID Year Title