Property Summary

NCBI Gene PubMed Count 15
Grant Count 8
R01 Count 5
Funding $640,257.67
PubMed Score 9.73
PubTator Score 9.59

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26976594 The myosin V structure reveals the detailed rearrangements underlying myosin force generation as well as the basis of strain-dependent ADP release that is essential for processive myosins, such as myosin V.
26912658 Myo5c-globular tail domain and Myo5a-globular tail domain are not interchangeable in terms of inhibiting the motor function.
25324551 Rab38 and its close homolog Rab32 bind to Myosin Vc but not to Myosin Va or Myosin Vb. Binding depends on residues in the switch II region of Rab32 and Rab38 and regions of the Myosin Vc coiled-coil tail domain.
24339992 Structural insights into the globular tails of the human type v myosins Myo5a, Myo5b, And Myo5c.
24097982 the cargo-binding domain (CBD) structures of the three human MyoV paralogs (Va, Vb, and Vc), revealing subtle structural changes that drive functional differentiation and a novel redox mechanism controlling the CBD dimerization process
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19741097 These results provide the first live-cell imaging of Myo5c and indicate that Myo5c functions in secretory granule trafficking.
19641326 These data suggest that Myo5c associated with Rab8 is involved in the release of dengue virus 2 from HepG2 cells.
19008234 related Rab protein, Rab10, can interact with myosin Va, myosin Vb, and myosin Vc
18201966 Kinetic simulations reveal that the high ADP affinity of actomyosin Vc may lead to elevations of the duty ratio of myosin Vc to as high as 64% under possible physiological ADP concentrations
More...

AA Sequence

MAVAELYTQYNRVWIPDPEEVWKSAEIAKDYRVGDKVLRLLLEDGTELDYSVNPESLPPLRNPDILVGEN      1 - 70
DLTALSYLHEPAVLHNLRIRFAESKLIYTYSGIILVAMNPYKQLPIYGDAIIHAYSGQNMGDMDPHIFAV     71 - 140
AEEAYKQMARNNRNQSIIVSGESGAGKTVSARYAMRYFATVSKSGSNAHVEDKVLASNPITEAVGNAKTT    141 - 210
RNDNSSRFGKYTEISFDEQNQIIGANMSTYLLEKSRVVFQSENERNYHIFYQLCASAQQSEFKHLKLGSA    211 - 280
EEFNYTRMGGNTVIEGVNDRAEMVETQKTFTLLGFKEDFQMDVFKILAAILHLGNVQITAVGNERSSVSE    281 - 350
DDSHLKVFCELLGLESGRVAQWLCNRKIVTSSETVVKPMTRPQAVNARDALAKKIYAHLFDFIVERINQA    351 - 420
LQFSGKQHTFIGVLDIYGFETFDVNSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEDIPWTLIDFYDN    421 - 490
QPVIDLIEAKMGILELLDEECLLPHGTDENWLQKLYNNFVNRNPLFEKPRMSNTSFVIQHFADKVEYKCE    491 - 560
GFLEKNRDTVYDMLVEILRASKFHLCANFFQENPTPPSPFGSMITVKSAKQVIKPNSKHFRTTVGSKFRS    561 - 630
SLYLLMETLNATTPHYVRCIKPNDEKLPFEFDSKRIVQQLRACGVLETIRISAQSYPSRWTYIEFYSRYG    631 - 700
ILMTKQELSFSDKKEVCKVVLHRLIQDSNQYQFGKTKIFFRAGQVAYLEKLRLDKLRQSCVMVQKHMRGW    701 - 770
LQRKKFLRERRAALIIQQYFRGQQTVRKAITAVALKEAWAAIIIQKHCRGYLVRSLYQLIRMATITMQAY    771 - 840
SRGFLARRRYRKMLEEHKAVILQKYARAWLARRRFQSIRRFVLNIQLTYRVQRLQKKLEDQNKENHGLVE    841 - 910
KLTSLAALRAGDVEKIQKLEAELEKAATHRRNYEEKGKRYRDAVEEKLAKLQKHNSELETQKEQIQLKLQ    911 - 980
EKTEELKEKMDNLTKQLFDDVQKEERQRMLLEKSFELKTQDYEKQIQSLKEEIKALKDEKMQLQHLVEGE    981 - 1050
HVTSDGLKAEVARLSKQVKTISEFEKEIELLQAQKIDVEKHVQSQKREMREKMSEITKQLLESYDIEDVR   1051 - 1120
SRLSVEDLEHLNEDGELWFAYEGLKKATRVLESHFQSQKDCYEKEIEALNFKVVHLSQEINHLQKLFREE   1121 - 1190
NDINESIRHEVTRLTSENMMIPDFKQQISELEKQKQDLEIRLNEQAEKMKGKLEELSNQLHRSQEEEGTQ   1191 - 1260
RKALEAQNEIHTKEKEKLIDKIQEMQEASDHLKKQFETESEVKCNFRQEASRLTLENRDLEEELDMKDRV   1261 - 1330
IKKLQDQVKTLSKTIGKANDVHSSSGPKEYLGMLQYKREDEAKLIQNLILDLKPRGVVVNMIPGLPAHIL   1331 - 1400
FMCVRYADSLNDANMLKSLMNSTINGIKQVVKEHLEDFEMLSFWLSNTCHFLNCLKQYSGEEEFMKHNSP   1401 - 1470
QQNKNCLNNFDLSEYRQILSDVAIRIYHQFIIIMEKNIQPIIVPGMLEYESLQGISGLKPTGFRKRSSSI   1471 - 1540
DDTDGYTMTSVLQQLSYFYTTMCQNGLDPELVRQAVKQLFFLIGAVTLNSLFLRKDMCSCRKGMQIRCNI   1541 - 1610
SYLEEWLKDKNLQNSLAKETLEPLSQAAWLLQVKKTTDSDAKEIYERCTSLSAVQIIKILNSYTPIDDFE   1611 - 1680
KRVTPSFVRKVQALLNSREDSSQLMLDTKYLFQVTFPFTPSPHALEMIQIPSSFKLGFLNRL           1681 - 1742
//

Text Mined References (17)

PMID Year Title
26976594 2016 Force-producing ADP state of myosin bound to actin.
26912658 2016 Identification of the Isoform-specific Interactions between the Tail and the Head of Class V Myosin.
25324551 2014 Myosin vc interacts with Rab32 and Rab38 proteins and works in the biogenesis and secretion of melanosomes.
24339992 2013 Structural insights into the globular tails of the human type v myosins Myo5a, Myo5b, And Myo5c.
24097982 2013 Structural insights into functional overlapping and differentiation among myosin V motors.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19741097 2009 Myosin Vc is a molecular motor that functions in secretory granule trafficking.
19641326 2009 Myosin Vc, a member of the actin motor family associated with Rab8, is involved in the release of DV2 from HepG2 cells.
19008234 2009 Alternative splicing in class V myosins determines association with Rab10.
More...