Property Summary

NCBI Gene PubMed Count 57
PubMed Score 383.88
PubTator Score 193.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Hyperekplexia 16 5.999 3.0

Expression

  Differential Expression (16)

Disease log2 FC p
Alzheimer's disease -1.100 3.6e-02
atypical teratoid / rhabdoid tumor -1.500 1.4e-02
ductal carcinoma in situ -1.200 3.9e-03
ependymoma -1.300 6.6e-09
glioblastoma -1.200 1.1e-03
group 4 medulloblastoma 1.200 3.4e-03
invasive ductal carcinoma -1.100 3.4e-02
lung carcinoma 1.100 5.3e-24
medulloblastoma, large-cell 1.100 5.0e-03
osteosarcoma 1.102 2.3e-03
ovarian cancer -1.400 7.1e-05
pancreatic ductal adenocarcinoma liver m... -2.439 2.9e-04
pediatric high grade glioma -1.300 7.6e-05
Pick disease -1.200 1.5e-04
subependymal giant cell astrocytoma -2.300 5.8e-03
tuberculosis 1.200 1.3e-06

Gene RIF (33)

AA Sequence

MATEGMILTNHDHQIRVGVLTVSDSCFRNLAEDRSGINLKDLVQDPSLLGGTISAYKIVPDEIEEIKETL      1 - 70
IDWCDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVCGIRGKTL     71 - 140
IINLPGSKKGSQECFQFILPALPHAIDLLRDAIVKVKEVHDELEDLPSPPPPLSPPPTTSPHKQTEDKGV    141 - 210
QCEEEEEEKKDSGVASTEDSSSSHITAAAIAAKIPDSIISRGVQVLPRDTASLSTTPSESPRAQATSRLS    211 - 280
TASCPTPKVQSRCSSKENILRASHSAVDITKVARRHRMSPFPLTSMDKAFITVLEMTPVLGTEIINYRDG    281 - 350
MGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQPTQTVMPGQVMRVTTGAPIPCG    351 - 420
ADAVVQVEDTELIRESDDGTEELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGV    421 - 490
TEVEVNKFPVVAVMSTGNELLNPEDDLLPGKIRDSNRSTLLATIQEHGYPTINLGIVGDNPDDLLNALNE    491 - 560
GISRADVIITSGGVSMGEKDYLKQVLDIDLHAQIHFGRVFMKPGLPTTFATLDIDGVRKIIFALPGNPVS    561 - 630
AVVTCNLFVVPALRKMQGILDPRPTIIKARLSCDVKLDPRPEYHRCILTWHHQEPLPWAQSTGNQMSSRL    631 - 700
MSMRSANGLLMLPPKTEQYVELHKGEVVDVMVIGRL                                      701 - 736
//

Text Mined References (64)

PMID Year Title