Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.63
PubTator Score 3.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma 1.400 2.6e-02
head and neck cancer -1.900 3.1e-03
interstitial cystitis -1.400 8.4e-03
interstitial lung disease 1.100 3.4e-02
intraductal papillary-mucinous carcinoma... -1.300 2.5e-04
osteosarcoma 1.638 9.7e-04
ovarian cancer -1.400 6.8e-07
psoriasis -1.400 2.1e-36

Pathway (1)

Gene RIF (3)

AA Sequence

MLKPGDPGGSAFLKVDPAYLQHWQQLFPHGGAGPLKGSGAAGLLSAPQPLQPPPPPPPPERAEPPPDSLR      1 - 70
PRPASLSSASSTPASSSTSASSASSCAAAAAAAALAGLSALPVSQLPVFAPLAAAAVAAEPLPPKELCLG     71 - 140
ATSGPGPVKCGGGGGGGGEGRGAPRFRCSAEELDYYLYGQQRMEIIPLNQHTSDPNNRCDMCADNRNGEC    141 - 210
PMHGPLHSLRRLVGTSSAAAAAPPPELPEWLRDLPREVCLCTSTVPGLAYGICAAQRIQQGTWIGPFQGV    211 - 280
LLPPEKVQAGAVRNTQHLWEIYDQDGTLQHFIDGGEPSKSSWMRYIRCARHCGEQNLTVVQYRSNIFYRA    281 - 350
CIDIPRGTELLVWYNDSYTSFFGIPLQCIAQDENLNVPSTVMEAMCRQDALQPFNKSSKLAPTTQQRSVV    351 - 420
FPQTPCSRNFSLLDKSGPIESGFNQINVKNQRVLASPTSTSQLHSEFSDWHLWKCGQCFKTFTQRILLQM    421 - 490
HVCTQNPDRPYQCGHCSQSFSQPSELRNHVVTHSSDRPFKCGYCGRAFAGATTLNNHIRTHTGEKPFKCE    491 - 560
RCERSFTQATQLSRHQRMPNECKPITESPESIEVD                                       561 - 595
//

Text Mined References (8)

PMID Year Title