Property Summary

NCBI Gene PubMed Count 5
Grant Count 1
Funding $7,486.57
PubMed Score 6.56
PubTator Score 3.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
interstitial lung disease 1.100 0.034
osteosarcoma 1.638 0.001
posterior fossa group A ependymoma 3.000 0.000
intraductal papillary-mucinous carcinoma... -1.300 0.000
interstitial cystitis -1.400 0.008
ovarian cancer -1.400 0.000
head and neck cancer -1.900 0.003
psoriasis -1.400 0.000

Synonym

Accession Q9NQX0 B5MCJ4 Q9NQW9
Symbols PDA3
KMT8C
PRISM

Gene

 Grant Application (1)

Gene RIF (2)

PMID Text
25035420 Three novel loci were identified in East Asians with cardiac arrhythmias: rs2483280 (PRDM16 locus) and rs335206 (PRDM6 locus) were associated with QRS duration; and rs17026156 (SLC8A1 locus) correlated with PR interval.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLKPGDPGGSAFLKVDPAYLQHWQQLFPHGGAGPLKGSGAAGLLSAPQPLQPPPPPPPPERAEPPPDSLR      1 - 70
PRPASLSSASSTPASSSTSASSASSCAAAAAAAALAGLSALPVSQLPVFAPLAAAAVAAEPLPPKELCLG     71 - 140
ATSGPGPVKCGGGGGGGGEGRGAPRFRCSAEELDYYLYGQQRMEIIPLNQHTSDPNNRCDMCADNRNGEC    141 - 210
PMHGPLHSLRRLVGTSSAAAAAPPPELPEWLRDLPREVCLCTSTVPGLAYGICAAQRIQQGTWIGPFQGV    211 - 280
LLPPEKVQAGAVRNTQHLWEIYDQDGTLQHFIDGGEPSKSSWMRYIRCARHCGEQNLTVVQYRSNIFYRA    281 - 350
CIDIPRGTELLVWYNDSYTSFFGIPLQCIAQDENLNVPSTVMEAMCRQDALQPFNKSSKLAPTTQQRSVV    351 - 420
FPQTPCSRNFSLLDKSGPIESGFNQINVKNQRVLASPTSTSQLHSEFSDWHLWKCGQCFKTFTQRILLQM    421 - 490
HVCTQNPDRPYQCGHCSQSFSQPSELRNHVVTHSSDRPFKCGYCGRAFAGATTLNNHIRTHTGEKPFKCE    491 - 560
RCERSFTQATQLSRHQRMPNECKPITESPESIEVD                                       561 - 595
//

Text Mined References (7)

PMID Year Title
27716515 2016 Mutations in the Histone Modifier PRDM6 Are Associated with Isolated Nonsyndromic Patent Ductus Arteriosus.
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
25035420 2014 Identification of three novel genetic variations associated with electrocardiographic traits (QRS duration and PR interval) in East Asians.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16537907 2006 PRISM/PRDM6, a transcriptional repressor that promotes the proliferative gene program in smooth muscle cells.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
10668202 2000 The yin-yang of PR-domain family genes in tumorigenesis.