Property Summary

NCBI Gene PubMed Count 21
Grant Count 116
R01 Count 23
Funding $18,151,768.38
PubMed Score 289.51
PubTator Score 48.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.118 0.000
lung cancer 2.400 0.000
group 3 medulloblastoma 1.100 0.011
Pick disease -1.100 0.000
ovarian cancer 1.500 0.000
dermatomyositis 1.400 0.002

Synonym

Accession Q9NQW7 A8K071 G5E9Y2 G8JLB2 O15250 Q53EX6 Q8N3Q0 Q96D23
Symbols APP1
SAMP
XPNPEP
XPNPEPL
XPNPEPL1

Gene

PDB

3CTZ  

Gene RIF (5)

PMID Text
21052031 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20460270 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19126663 These data suggest that progesterone-induced increases in AP-P may contribute to the development of oral contraceptive pill-induced hypertension in susceptible Women.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHA      1 - 70
AMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAG     71 - 140
HHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFN    141 - 210
LRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCA    211 - 280
DLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEK    281 - 350
EVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQY    351 - 420
KDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHG    421 - 490
VGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFE    491 - 560
PLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH           561 - 623
//

Text Mined References (26)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
21052031 2011 Identification of genetic factors associated with susceptibility to angiotensin-converting enzyme inhibitors-induced cough.
20460270 2010 Genome-wide association study identifies a susceptibility locus for biliary atresia on 10q24.2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19126663 2008 The bradykinin-degrading aminopeptidase P is increased in women taking the oral contraceptive pill.
More...