Property Summary

NCBI Gene PubMed Count 21
PubMed Score 296.93
PubTator Score 48.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis 1.400 1.9e-03
group 3 medulloblastoma 1.100 1.1e-02
lung cancer 2.400 4.9e-04
osteosarcoma 1.118 7.1e-05
ovarian cancer -1.300 5.3e-06
Pick disease -1.100 2.1e-04

Gene RIF (5)

AA Sequence

MPPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHA      1 - 70
AMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAG     71 - 140
HHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFN    141 - 210
LRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCA    211 - 280
DLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEK    281 - 350
EVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQY    351 - 420
KDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHG    421 - 490
VGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFE    491 - 560
PLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH           561 - 623
//

Text Mined References (26)

PMID Year Title