Property Summary

NCBI Gene PubMed Count 43
PubMed Score 193.55
PubTator Score 35.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 1.243 5.3e-03
adrenocortical carcinoma 2.401 3.0e-04
Astrocytoma, Pilocytic -1.400 6.1e-03
Atopic dermatitis 1.300 8.0e-03
Breast cancer 2.000 2.5e-10
breast carcinoma 1.100 2.1e-05
chronic rhinosinusitis 1.442 4.0e-02
cystic fibrosis and chronic rhinosinusit... 1.336 9.7e-03
ductal carcinoma in situ 1.700 3.2e-03
Endometriosis 1.918 2.6e-02
ependymoma -1.400 1.7e-04
intraductal papillary-mucinous carcinoma... 3.700 5.9e-05
intraductal papillary-mucinous neoplasm ... 1.100 1.3e-03
invasive ductal carcinoma 1.900 5.3e-03
lung adenocarcinoma 1.900 7.8e-10
nasopharyngeal carcinoma 1.600 4.4e-03
non-small cell lung cancer 3.237 2.3e-33
osteosarcoma 2.374 4.2e-02
ovarian cancer 1.800 4.7e-03
pancreatic cancer 1.900 2.4e-07
primary Sjogren syndrome 1.100 1.8e-02
progressive supranuclear palsy -1.900 1.3e-02
psoriasis 1.200 2.1e-17
subependymal giant cell astrocytoma -3.466 6.7e-03
ulcerative colitis 1.400 3.5e-04

Gene RIF (25)

AA Sequence

MDPFTEKLLERTRARRENLQRKMAERPTAAPRSMTHAKRARQPLSEASNQQPLSGGEEKSCTKPSPSKKR      1 - 70
CSDNTEVEVSNLENKQPVESTSAKSCSPSPVSPQVQPQAADTISDSVAVPASLLGMRRGLNSRLEATAAS     71 - 140
SVKTRMQKLAEQRRRWDNDDMTDDIPESSLFSPMPSEEKAASPPRPLLSNASATPVGRRGRLANLAATIC    141 - 210
SWEDDVNHSFAKQNSVQEQPGTACLSKFSSASGASARINSSSVKQEATFCSQRDGDASLNKALSSSADDA    211 - 280
SLVNASISSSVKATSPVKSTTSITDAKSCEGQNPELLPKTPISPLKTGVSKPIVKSTLSQTVPSKGELSR    281 - 350
EICLQSQSKDKSTTPGGTGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSST    351 - 420
THLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETHCQSTPLKKHQGVSKTQSLPVTE    421 - 490
KVTENQIPAKNSSTEPKGFTECEMTKSSPLKITLFLEEDKSLKVTSDPKVEQKIEVIREIEMSVDDDDIN    491 - 560
SSKVINDLFSDVLEEGELDMEKSQEEMDQALAESSEEQEDALNISSMSLLAPLAQTVGVVSPESLVSTPR    561 - 630
LELKDTSRSDESPKPGKFQRTRVPRAESGDSLGSEDRDLLYSIDAYRSQRFKETERPSIKQVIVRKEDVT    631 - 700
SKLDEKNNAFPCQVNIKQKMQELNNEINMQQTVIYQASQALNCCVDEEHGKGSLEEAEAERLLLIATGKR    701 - 770
TLLIDELNKLKNEGPQRKNKASPQSEFMPSKGSVTLSEIRLPLKADFVCSTVQKPDAANYYYLIILKAGA    771 - 840
ENMVATPLASTSNSLNGDALTFTTTFTLQDVSNDFEINIEVYSLVQKKDPSGLDKKKKTSKSKAITPKRL    841 - 910
LTSITTKSNIHSSVMASPGGLSAVRTSNFALVGSYTLSLSSVGNTKFVLDKVPFLSSLEGHIYLKIKCQV    911 - 980
NSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDEKRKNPIGRINLANCTSRQIEPANREFC    981 - 1050
ARRNTFELITVRPQREDDRETLVSQCRDTLCVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQPDACYKP   1051 - 1120
IGKP                                                                     1121 - 1124
//

Text Mined References (56)

PMID Year Title