Property Summary

NCBI Gene PubMed Count 38
PubMed Score 168.14
PubTator Score 35.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Polycystic Ovary Syndrome 335
Disease Target Count P-value
non-small cell lung cancer 2798 4.96274500053655E-40
breast carcinoma 1614 1.32723461572878E-38
Breast cancer 3099 9.25303975680508E-23
lung adenocarcinoma 2714 3.194287804151E-11
pancreatic cancer 2300 5.14846048765004E-8
adrenocortical carcinoma 1427 1.34644671318482E-7
psoriasis 6685 3.67540958419256E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.89822134621903E-5
posterior fossa group B ependymoma 1530 7.28761581026077E-5
ulcerative colitis 2087 1.98263616600137E-4
Atopic dermatitis 944 2.96596275863012E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.35697807046937E-4
ductal carcinoma in situ 1745 4.72865190839194E-4
invasive ductal carcinoma 2950 5.29595436320115E-4
nasopharyngeal carcinoma 1056 0.00222593731314997
subependymal giant cell astrocytoma 2287 0.00365675074053891
ovarian cancer 8492 0.00472936074409109
active Crohn's disease 918 0.0052967064531139
cystic fibrosis and chronic rhinosinusitis 213 0.00968541068703191
Endometriosis 535 0.0111243627256829
pilocytic astrocytoma 3086 0.0120603929256087
progressive supranuclear palsy 674 0.0129062608338955
primary Sjogren syndrome 789 0.0181942799822767
chronic rhinosinusitis 512 0.0401045975740045
osteosarcoma 7933 0.0424113205105637
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q9NQW6 Q5CZ78 Q6NSK5 Q9H8Y4 Q9NVN9 Q9NVP0
Symbols scra
FSGS8
Scraps

Gene

PDB

4XOI   2Y7B   4XH3  

  Ortholog (11)

Gene RIF (20)

PMID Text
26486082 Findings indicate that miR-497 is a potent tumor suppressor that inhibits cancer phenotypes by targeting ANLN and HSPA4L in NPC.
26319989 Identification 4 novel and 18 known exonic ANLN variants associated with carotid intima-media thickness at bifurcation.
26135313 High nuclear expression of anillin (ANLN) is an independent predictor of poor disease-specific survival and it is a useful prognostic marker of urothelial carcinoma of the upper urinary tract (UCUT).
25809162 Anillin regulates intercellular adhesion in model human epithelia by mechanisms involving the suppression of JNK activity and controlling the assembly of the perijunctional cytoskeleton.
25359885 these data demonstrate that a complex of p190RhoGAP-A and anillin modulates RhoA-GTP levels in the cytokinetic furrow to ensure progression of cytokinesis.
25223638 Data suggest that anillin (ANLN) could be involved in breast cancer progression and a potential target candidate in breast cancer.
24994938 The sequestration of anillin by astral microtubules might alter the organization of cortical proteins to polarize cells for cytokinesis
24809965 ANLN is positively associated with Wnt/beta-catenin signaling in gastric cancer.Elevated expression of ANLN is a predictor of intestinal type gastric cancer. ER-alpha is negatively associated with the expression of ANLN in gastric cancer.
24676636 Identified a missense mutation R431C in anillin (ANLN), an F-actin binding cell cycle gene, as a cause of FSGS. We screened 250 additional families with FSGS and found another variant, G618C, that segregates with disease in a second family with FSGS.
24088567 Supervillin concentrates activated and total myosin II at the furrow, and simultaneous knockdown of supervillin and anillin additively increases cell division failure.
More...

AA Sequence

MDPFTEKLLERTRARRENLQRKMAERPTAAPRSMTHAKRARQPLSEASNQQPLSGGEEKSCTKPSPSKKR      1 - 70
CSDNTEVEVSNLENKQPVESTSAKSCSPSPVSPQVQPQAADTISDSVAVPASLLGMRRGLNSRLEATAAS     71 - 140
SVKTRMQKLAEQRRRWDNDDMTDDIPESSLFSPMPSEEKAASPPRPLLSNASATPVGRRGRLANLAATIC    141 - 210
SWEDDVNHSFAKQNSVQEQPGTACLSKFSSASGASARINSSSVKQEATFCSQRDGDASLNKALSSSADDA    211 - 280
SLVNASISSSVKATSPVKSTTSITDAKSCEGQNPELLPKTPISPLKTGVSKPIVKSTLSQTVPSKGELSR    281 - 350
EICLQSQSKDKSTTPGGTGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSST    351 - 420
THLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETHCQSTPLKKHQGVSKTQSLPVTE    421 - 490
KVTENQIPAKNSSTEPKGFTECEMTKSSPLKITLFLEEDKSLKVTSDPKVEQKIEVIREIEMSVDDDDIN    491 - 560
SSKVINDLFSDVLEEGELDMEKSQEEMDQALAESSEEQEDALNISSMSLLAPLAQTVGVVSPESLVSTPR    561 - 630
LELKDTSRSDESPKPGKFQRTRVPRAESGDSLGSEDRDLLYSIDAYRSQRFKETERPSIKQVIVRKEDVT    631 - 700
SKLDEKNNAFPCQVNIKQKMQELNNEINMQQTVIYQASQALNCCVDEEHGKGSLEEAEAERLLLIATGKR    701 - 770
TLLIDELNKLKNEGPQRKNKASPQSEFMPSKGSVTLSEIRLPLKADFVCSTVQKPDAANYYYLIILKAGA    771 - 840
ENMVATPLASTSNSLNGDALTFTTTFTLQDVSNDFEINIEVYSLVQKKDPSGLDKKKKTSKSKAITPKRL    841 - 910
LTSITTKSNIHSSVMASPGGLSAVRTSNFALVGSYTLSLSSVGNTKFVLDKVPFLSSLEGHIYLKIKCQV    911 - 980
NSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDEKRKNPIGRINLANCTSRQIEPANREFC    981 - 1050
ARRNTFELITVRPQREDDRETLVSQCRDTLCVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQPDACYKP   1051 - 1120
IGKP                                                                     1121 - 1124
//

Text Mined References (51)

PMID Year Title
26486082 2015 The potent tumor suppressor miR-497 inhibits cancer phenotypes in nasopharyngeal carcinoma by targeting ANLN and HSPA4L.
26319989 2015 Sequencing of candidate genes in Dominican families implicates both rare exonic and common non-exonic variants for carotid intima-media thickness at bifurcation.
26135313 2015 Subcellular localisation of anillin is associated with different survival outcomes in upper urinary tract urothelial carcinoma.
25809162 2015 F-actin binding protein, anillin, regulates integrity of intercellular junctions in human epithelial cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25359885 2015 A complex of p190RhoGAP-A and anillin modulates RhoA-GTP and the cytokinetic furrow in human cells.
25223638 2015 Knockdown of ANLN by lentivirus inhibits cell growth and migration in human breast cancer.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24994938 2014 Anillin interacts with microtubules and is part of the astral pathway that defines cortical domains.
More...