Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.69
PubTator Score 2.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.200 0.002

Gene RIF (2)

PMID Text
18231586 Evolutionary analysis suggests that human PRDM7 and PRDM9 genes, a pair of close paralogs corresponding to a single mouse gene Prdm9, were generated by a recent gene duplication event after the divergence of the ancestors of human and mouse.
18187620 Knockdown of PR domain containing 7 (PRDM7) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MSPERSQEESPEGDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKMNYNALITVGLRATR      1 - 70
PAFMCHRRQAIKLQVDDTEDSDEEWTPRQQVKPPWMAFRGEQSKHQKGMPKASFNNESSLRELSGTPNLL     71 - 140
NTSDSEQAQKPVSPPGEASTSGQHSRLKLELRRKETEGKMYSLRERKGHAYKEISEPQDDDYLYCEMCQN    141 - 210
FFIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRI    211 - 280
TEDEEAANSGYSWLITKGRNCYEYVDGKDKSSANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPG    281 - 350
CELLVWSGDEYGQELGIRSSIEPAESLGQAVNCWSGMGMSMARNWASSGAASGRKSSWQGENQSQRSIHV    351 - 420
PHAVWPFQVKNFSVNMWNAITPLRTSQDHLQENFSNQRIPAQGIRIRSGNILIHAAVMTKPKVKRSKKGP    421 - 490
NS                                                                        491 - 492
//

Text Mined References (9)

PMID Year Title
27129774 2016 PR Domain-containing Protein 7 (PRDM7) Is a Histone 3 Lysine 4 Trimethyltransferase.
25416956 2014 A proteome-scale map of the human interactome network.
18231586 2008 Genome-wide survey and developmental expression mapping of zebrafish SET domain-containing genes.
17916234 2007 Family expansion and gene rearrangements contributed to the functional specialization of PRDM genes in vertebrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14759258 2004 An unappreciated role for RNA surveillance.
14675547 2003 SET domains and histone methylation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10668202 2000 The yin-yang of PR-domain family genes in tumorigenesis.