Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.69
PubTator Score 2.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
diabetes mellitus 1728 2.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Li-Fraumeni syndrome 13 3.332 1.7
Turner syndrome 28 3.252 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.200 2.0e-03

Gene RIF (3)

AA Sequence

MSPERSQEESPEGDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKMNYNALITVGLRATR      1 - 70
PAFMCHRRQAIKLQVDDTEDSDEEWTPRQQVKPPWMAFRGEQSKHQKGMPKASFNNESSLRELSGTPNLL     71 - 140
NTSDSEQAQKPVSPPGEASTSGQHSRLKLELRRKETEGKMYSLRERKGHAYKEISEPQDDDYLYCEMCQN    141 - 210
FFIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRI    211 - 280
TEDEEAANSGYSWLITKGRNCYEYVDGKDKSSANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPG    281 - 350
CELLVWSGDEYGQELGIRSSIEPAESLGQAVNCWSGMGMSMARNWASSGAASGRKSSWQGENQSQRSIHV    351 - 420
PHAVWPFQVKNFSVNMWNAITPLRTSQDHLQENFSNQRIPAQGIRIRSGNILIHAAVMTKPKVKRSKKGP    421 - 490
NS                                                                        491 - 492
//

Text Mined References (9)

PMID Year Title