Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.65
PubTator Score 2.74

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NQV8 A8K7X2 Q6IQ36
Symbols PFM5
EPM10
KMT8D

Gene

AA Sequence

MEDTGIQRGIWDGDAKAVQQCLTDIFTSVYTTCDIPENAIFGPCVLSHTSLYDSIAFIALKSTDKRTVPY      1 - 70
IFRVDTSAANGSSEGLMWLRLVQSARDKEEQNLEAYIKNGQLFYRSLRRIAKDEELLVWYGKELTELLLL     71 - 140
CPSRSHNKMNGSSPYTCLECSQRFQFEFPYVAHLRFRCPKRLHSADISPQDEQGGGVGTKDHGGGGGGGK    141 - 210
DQQQQQQEAPLGPGPKFCKAGPLHHYPSPSPESSNPSAAAGGSSAKPSTDFHNLARELENSRGGSSCSPA    211 - 280
QSLSSGSGSGGGGGHQEAELSPDGIATGGGKGKRKFPEEAAEGGGGAGLVGGRGRFVERPLPASKEDLVC    281 - 350
TPQQYRASGSYFGLEENGRLFAPPSPETGEAKRSAFVEVKKAARAASLQEEGTADGAGVASEDQDAGGGG    351 - 420
GSSTPAAASPVGAEKLLAPRPGGPLPSRLEGGSPARGSAFTSVPQLGSAGSTSGGGGTGAGAAGGAGGGQ    421 - 490
GAASDERKSAFSQPARSFSQLSPLVLGQKLGALEPCHPADGVGPTRLYPAAADPLAVKLQGAADLNGGCG    491 - 560
SLPSGGGGLPKQSPFLYATAFWPKSSAAAAAAAAAAAAGPLQLQLPSALTLLPPSFTSLCLPAQNWCAKC    561 - 630
NASFRMTSDLVYHMRSHHKKEYAMEPLVKRRREEKLKCPICNESFRERHHLSRHMTSHN               631 - 689
//

Text Mined References (12)

PMID Year Title
26023183 2015 Transcription factor PRDM8 is required for rod bipolar and type 2 OFF-cone bipolar cell survival and amacrine subtype identity.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
22961547 2012 Early-onset Lafora body disease.
22284184 2012 Bhlhb5 and Prdm8 form a repressor complex involved in neuronal circuit assembly.
19646955 2009 Histone methyltransferase PRDM8 regulates mouse testis steroidogenesis.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14675547 2003 SET domains and histone methylation.
More...