Property Summary

NCBI Gene PubMed Count 28
Grant Count 34
R01 Count 15
Funding $8,089,171.76
PubMed Score 90.40
PubTator Score 69.24

Knowledge Summary

Patent

No data available

Gene RIF (23)

PMID Text
27045445 The article outlines the role of PRDM9 in fertility.
26840484 subspecies-specific degradation of PRDM9 binding sites by meiotic drive, which steadily increases asymmetric PRDM9 binding, has impacts beyond simply changing hotspot positions, and strongly support a direct involvement in hybrid infertility
26833727 Allele C was found to bind a C-specific hot spot with higher affinity than allele A bound A-specific hot spots
26368021 PRDM9 protein variants form functional heteromeric complexes which can bind hotspots sequences. When a heteromeric complex binds at a hotspot of one PRDM9 variant, the other PRDM9 variant, which would otherwise not bind, methylates hotspot nucleosomes
25393762 This depletion of PRDM9 genomic targets is expected to decrease fitness, and thereby to favor new PRDM9 alleles binding different motifs
25001002 Alignment of Neandertal and Denisovan sequences suggests that PRDM9 in archaic hominins was closely related to present-day human alleles that are rare and specific to African populations.
24754746 Results confirm an association between rare variant PRDM9 alleic forms and childhood ALL
24634223 Overexpression of PRDM9 in HEK293 cells also resulted in a significant increase in trimethylated H3K36 and H3K4 further confirming our in vitro observations
23267059 Recombination regulator PRDM9 influences the instability of its own coding sequence in humans.
23222848 We identified PRDM9 as being associated with unusual recombination patterns and discovered a substantial excess of rare allelic forms of PRDM9 in two independent acute lymphoblastic leukemia cohorts.
More...

AA Sequence

MSPEKSQEESPEEDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKRNYNALITIGLRATR      1 - 70
PAFMCHRRQAIKLQVDDTEDSDEEWTPRQQVKPPWMALRVEQRKHQKGMPKASFSNESSLKELSRTANLL     71 - 140
NASGSEQAQKPVSPSGEASTSGQHSRLKLELRKKETERKMYSLRERKGHAYKEVSEPQDDDYLYCEMCQN    141 - 210
FFIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRI    211 - 280
TEDEEAANNGYSWLITKGRNCYEYVDGKDKSWANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPG    281 - 350
CELLVWYGDEYGQELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQKFLSQHVERNHSSQNFPGPS    351 - 420
ARKLLQPENPCPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPPKGQMGSCRVG    421 - 490
KRIMEEESRTGQKVNPGNTGKLFVGVGISRIAKVKYGECGQGFSVKSDVITHQRTHTGEKLYVCRECGRG    491 - 560
FSWKSHLLIHQRIHTGEKPYVCRECGRGFSWQSVLLTHQRTHTGEKPYVCRECGRGFSRQSVLLTHQRRH    561 - 630
TGEKPYVCRECGRGFSRQSVLLTHQRRHTGEKPYVCRECGRGFSWQSVLLTHQRTHTGEKPYVCRECGRG    631 - 700
FSWQSVLLTHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLRHQRTH    701 - 770
TGEKPYVCRECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRG    771 - 840
FRNKSHLLRHQRTHTGEKPYVCRECGRGFSDRSSLCYHQRTHTGEKPYVCREDE                    841 - 894
//

Text Mined References (30)

PMID Year Title
27045445 2016 X marks the spot: PRDM9 rescues hybrid sterility by finding hidden treasure in the genome.
26840484 2016 Re-engineering the zinc fingers of PRDM9 reverses hybrid sterility in mice.
26833727 2016 Structural basis for human PRDM9 action at recombination hot spots.
26368021 2015 Multimer Formation Explains Allelic Suppression of PRDM9 Recombination Hotspots.
25395542 2014 DNA recombination. Recombination initiation maps of individual human genomes.
25393762 2014 The red queen model of recombination hotspots evolution in the light of archaic and modern human genomes.
25001002 2014 Primate evolution of the recombination regulator PRDM9.
24754746 2014 Allelic variants of PRDM9 associated with high hyperdiploid childhood acute lymphoblastic leukaemia.
24634223 2014 Trimethylation of histone H3 lysine 36 by human methyltransferase PRDM9 protein.
24136506 2013 Meiotic recombination in mammals: localization and regulation.
More...