Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.01
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -3.300 2.7e-02
chronic rhinosinusitis -1.059 5.4e-03
glioblastoma -1.200 1.5e-02
interstitial cystitis -1.400 1.4e-03
lung adenocarcinoma -1.100 5.1e-09
osteosarcoma -1.106 2.2e-02
ovarian cancer -1.200 1.1e-02
tuberculosis and treatment for 6 months -1.200 1.6e-05

Gene RIF (1)

AA Sequence

MLKMAEPIASLMIVECRACLRCSPLFLYQREKDRMTENMKECLAQTNAAVGDMVTVVKTEVCSPLRDQEY      1 - 70
GQPCSRRPDSSAMEVEPKKLKGKRDLIVPKSFQQVDFWFCESCQEYFVDECPNHGPPVFVSDTPVPVGIP     71 - 140
DRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGPYEGQISTQDKSAGFFSWLIVDKNNRYKSIDGS    141 - 210
DETKANWMRYVVISREEREQNLLAFQHSERIYFRACRDIRPGEWLRVWYSEDYMKRLHSMSQETIHRNLA    211 - 280
RGEKRLQREKSEQVLDNPEDLRGPIHLSVLRQGKSPYKRGFDEGDVHPQAKKKKIDLIFKDVLEASLESA    281 - 350
KVEAHQLALSTSLVIRKVPKYQDDAYSQCATTMTHGVQNIGQTQGEGDWKVPQGVSKEPGQLEDEEEEPS    351 - 420
SFKADSPAEASLASDPHELPTTSFCPNCIRLKKKVRELQAELDMLKSGKLPEPPVLPPQVLELPEFSDPA    421 - 490
GKLVWMRLLSEGRVRSGLCGG                                                     491 - 511
//

Text Mined References (10)

PMID Year Title