Property Summary

NCBI Gene PubMed Count 6
Grant Count 5
Funding $1,599,734.5
PubMed Score 5.80
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.106 0.022
glioblastoma -1.200 0.015
tuberculosis and treatment for 6 months -1.200 0.000
Breast cancer -3.300 0.027
interstitial cystitis -1.400 0.001
lung adenocarcinoma -1.100 0.000
ovarian cancer 1.300 0.000
chronic rhinosinusitis -1.059 0.005

Gene RIF (1)

PMID Text
25499759 We characterize PRDM11 as a putative novel tumor suppressor that controls the expression of key oncogenes, and we add new mechanistic insight into B-cell lymphomagenesis.

AA Sequence

MLKMAEPIASLMIVECRACLRCSPLFLYQREKDRMTENMKECLAQTNAAVGDMVTVVKTEVCSPLRDQEY      1 - 70
GQPCSRRPDSSAMEVEPKKLKGKRDLIVPKSFQQVDFWFCESCQEYFVDECPNHGPPVFVSDTPVPVGIP     71 - 140
DRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGPYEGQISTQDKSAGFFSWLIVDKNNRYKSIDGS    141 - 210
DETKANWMRYVVISREEREQNLLAFQHSERIYFRACRDIRPGEWLRVWYSEDYMKRLHSMSQETIHRNLA    211 - 280
RGEKRLQREKSEQVLDNPEDLRGPIHLSVLRQGKSPYKRGFDEGDVHPQAKKKKIDLIFKDVLEASLESA    281 - 350
KVEAHQLALSTSLVIRKVPKYQDDAYSQCATTMTHGVQNIGQTQGEGDWKVPQGVSKEPGQLEDEEEEPS    351 - 420
SFKADSPAEASLASDPHELPTTSFCPNCIRLKKKVRELQAELDMLKSGKLPEPPVLPPQVLELPEFSDPA    421 - 490
GKLVWMRLLSEGRVRSGLCGG                                                     491 - 511
//

Text Mined References (9)

PMID Year Title
25499759 2015 Loss of PRDM11 promotes MYC-driven lymphomagenesis.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24929828 2014 Genome-wide association analysis identifies six new loci associated with forced vital capacity.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14675547 2003 SET domains and histone methylation.
10668202 2000 The yin-yang of PR-domain family genes in tumorigenesis.