Property Summary

NCBI Gene PubMed Count 38
Grant Count 1
Funding $95,740
PubMed Score 40.43
PubTator Score 28.56

Knowledge Summary

Patent (10,514)

Expression

Synonym

Accession Q9NQU5 A8K2G2 B3KYB0 G5E9R2
Symbols PAK5

Gene

 Grant Application (1)

PDB

2ODB   2C30   4KS7   4KS8  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (20)

PMID Text
26459798 PAK6 is directly targeted by miR-328. miR-328 inhibits cell growth and promotes cell apoptosis in prostate cancer cells.
26442588 negative correlation between PAK6 and EZH2 expression was observed in hepatoma tissues from HCC patients. These data identified the tumor suppressive role and potential underlying mechanism of PAK6 in hepatocarcinogenesis
26375402 p21-activated kinase 6 (PAK6) as a novel interactor of leucine-rich repeat kinase 2 (LRRK2), a kinase involved in Parkinson's disease
26058485 the results of the present study suggested that miR-429 inhibits the migration and invasion of colon cancer cells, partly at least, by mediating the expression of PAK6, as well as the activity of cofilin signaling
25426562 we report that in colon cancer PAK6 promotes tumor progression and chemoresistance both in vitro and in vivo
24576777 PAK6 is overexpressed in hepatocellular carcinoma, compared with the adjacent noncancerous liver tissues, and is associated with poor prognosis.
24352566 PAK6 is specifically required for carcinoma cell-cell dissociation downstream of hepatocyte growth factor (HGF) for both DU145 prostate cancer and HT29 colon cancer cells.
24130878 These results demonstrate that androgen-stimulated PAK6 activation is mediated through a direct interaction between AR and PAK6 and PAK6 activation promotes prostate cancer cells motility and invasion.
23685956 PAK5 plays an essential role in the initiation and progression of hepatocellular carcinoma.
23132866 PAK6 phosphorylates Mdm2 on Thr-158 and Ser-186, which is critical for AR ubiquitin-mediated degradation.
More...

AA Sequence

MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRITRVQLQPMKTV      1 - 70
VRGSAMPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDEHWATDPDMYLQSPQSERTDP     71 - 140
HGLYLSCNGGTPAGHKQMPWPEPQSPRVLPNGLAAKAQSLGPAEFQGASQRCLQLGACLQSSPPGASPPT    141 - 210
GTNRHGMKAAKHGSEEARPQSCLVGSATGRPGGEGSPSPKTRESSLKRRLFRSMFLSTAATAPPSSSKPG    211 - 280
PPPQSKPNSSFRPPQKDNPPSLVAKAQSLPSDQPVGTFSPLTTSDTSSPQKSLRTAPATGQLPGRSSPAG    281 - 350
SPRTWHAQISTSNLYLPQDPTVAKGALAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGI    351 - 420
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEELWVLMEFLQGGALT    421 - 490
DIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRVKLSDFGFCAQISKDVPKRKS    491 - 560
LVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPPYFSDSPVQAMKRLRDSPPPKLKNSHKVSPV    561 - 630
LRDFLERMLVRDPQERATAQELLDHPFLLQTGLPECLVPLIQLYRKQTSTC                       631 - 681
//

Text Mined References (42)

PMID Year Title
26459798 2015 MicroRNA?328 directly targets p21?activated protein kinase 6 inhibiting prostate cancer proliferation and enhancing docetaxel sensitivity.
26442588 2015 Tumor Suppressive Function of p21-activated Kinase 6 in Hepatocellular Carcinoma.
26375402 2015 Leucine-rich repeat kinase 2 interacts with p21-activated kinase 6 to control neurite complexity in mammalian brain.
26058485 2015 MicroRNA-429 inhibits the migration and invasion of colon cancer cells by targeting PAK6/cofilin signaling.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25426562 2015 PAK6 increase chemoresistance and is a prognostic marker for stage II and III colon cancer patients undergoing 5-FU based chemotherapy.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24576777 2014 Expression and prognostic significance of p21-activated kinase 6 in hepatocellular carcinoma.
More...