Property Summary

NCBI Gene PubMed Count 36
PubMed Score 14.94
PubTator Score 20.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Pontocerebellar hypoplasia 36 6.242 3.1
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Microvillus inclusion disease 8 3.405 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.100 4.7e-02
group 3 medulloblastoma 1.100 3.4e-02
hepatocellular carcinoma 1.300 8.2e-05
non-small cell lung cancer 1.024 1.1e-10
osteosarcoma 1.923 2.4e-05
ovarian cancer 1.400 1.4e-03
pancreatic cancer 1.400 1.1e-02
pancreatic carcinoma 1.400 1.1e-02
tuberculosis -1.200 5.0e-04

Gene RIF (9)

AA Sequence

MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPG      1 - 70
LRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPAS     71 - 140
LSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKL    141 - 210
LAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES         211 - 275
//

Text Mined References (46)

PMID Year Title