Property Summary

NCBI Gene PubMed Count 33
PubMed Score 21.08
PubTator Score 7.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.4e-05
osteosarcoma 7950 6.3e-04
medulloblastoma, large-cell 6241 4.3e-03
Disease Target Count Z-score Confidence
cat-scratch disease 9 4.36 2.2
Leukemia 104 3.051 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.200 4.3e-03
osteosarcoma 1.249 6.3e-04
psoriasis 2.500 1.4e-05

Gene RIF (10)

AA Sequence

MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEI      1 - 70
FNKATLEVILRPKIGLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMA     71 - 140
LVDAGVPMRALFCGVACALDSDGTLVLDPTSKQEKEARAVLTFALDSVERKLLMSSTKGLYSDTELQQCL    141 - 210
AAAQAASQHVFRFYRESLQRRYSKS                                                 211 - 235
//

Text Mined References (39)

PMID Year Title