Property Summary

NCBI Gene PubMed Count 29
Grant Count 3
Funding $22,192.86
PubMed Score 21.10
PubTator Score 7.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 2.500 0.000
osteosarcoma 1.249 0.001
medulloblastoma, large-cell 1.200 0.004

Synonym

Accession Q9NQT4 Q32Q81 Q8NG16 Q96I89
Symbols p12B
RRP46
RRP41B
Rrp46p
hRrp46p

Gene

PDB

2NN6  

Gene RIF (10)

PMID Text
23392705 Further, subcellular co-localization assay showed that the two proteins could co-localize in the cytoplasm of K562 cells, but WT1/CML28 complexes were not detected by using immunoprecipitation.
22174317 HIV-1 Rev interacting protein, exosome component 5 (EXOSC5), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with EXOSC5 is increased by RRE
20660080 Results suggest that Rrp46 forms a homodimer separately from exosome complexes and, depending on species, is a structural component of the machinery that cleaves DNA during apoptosis.
19460752 HIV-1 Rev interacting protein, exosome component 5 (EXOSC5), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with EXOSC5 is increased by RRE
19460752 Knockdown of exosome component 5 (EXOSC5) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of exosome component 5 (EXOSC5) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18157497 rAAV/CML28-transduced DCs vaccine may serve as a feasible approach for the treatment of CML28-associated cancers.
16815301 These results in our study indicates gene silencing of SOCS1 remarkably enhanced the cytotoxicity efficiency of CML28 DNA vaccine in DCs.
12419256 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.
11812149 association of hCsl4p with the exosome is mediated by protein-protein interactions with hRrp42p and hRrp46p

AA Sequence

MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEI      1 - 70
FNKATLEVILRPKIGLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMA     71 - 140
LVDAGVPMRALFCGVACALDSDGTLVLDPTSKQEKEARAVLTFALDSVERKLLMSSTKGLYSDTELQQCL    141 - 210
AAAQAASQHVFRFYRESLQRRYSKS                                                 211 - 235
//

Text Mined References (36)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
23392705 2013 Interaction of human genes WT1 and CML28 in leukemic cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21791617 2011 DDX60, a DEXD/H box helicase, is a novel antiviral factor promoting RIG-I-like receptor-mediated signaling.
21515746 2011 Modulation of exosome-mediated mRNA turnover by interaction of GTP-binding protein 1 (GTPBP1) with its target mRNAs.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21255825 2011 The RNA exosome targets the AID cytidine deaminase to both strands of transcribed duplex DNA substrates.
More...