Property Summary

NCBI Gene PubMed Count 49
PubMed Score 97.51
PubTator Score 67.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Roberts syndrome 15 3.415 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 3.7e-02
group 3 medulloblastoma 1.900 9.4e-04
inflammatory breast cancer 1.200 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.300 2.0e-03
lung cancer 1.100 1.0e-03
non primary Sjogren syndrome sicca -1.100 2.0e-02
non-small cell lung cancer 1.011 3.1e-14
oligodendroglioma -1.400 3.3e-02
ulcerative colitis 1.100 2.9e-04

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (21)

AA Sequence

MGTTAPGPIHLLELCDQKLMEFLCNMDNKDLVWLEEIQEEAERMFTREFSKEPELMPKTPSQKNRRKKRR      1 - 70
ISYVQDENRDPIRRRLSRRKSRSSQLSSRRLRSKDSVEKLATVVGENGSVLRRVTRAAAAAAAATMALAA     71 - 140
PSSPTPESPTMLTKKPEDNHTQCQLVPVVEIGISERQNAEQHVTQLMSTEPLPRTLSPTPASATAPTSQG    141 - 210
IPTSDEESTPKKSKARILESITVSSLMATPQDPKGQGVGTGRSASKLRIAQVSPGPRDSPAFPDSPWRER    211 - 280
VLAPILPDNFSTPTGSRTDSQSVRHSPIAPSSPSPQVLAQKYSLVAKQESVVRRASRRLAKKTAEEPAAS    281 - 350
GRIICHSYLERLLNVEVPQKVGSEQKEPPEEAEPVAAAEPEVPENNGNNSWPHNDTEIANSTPNPKPAAS    351 - 420
SPETPSAGQQEAKTDQADGPREPPQSARRKRSYKQAVSELDEEQHLEDEELQPPRSKTPSSPCPASKVVR    421 - 490
PLRTFLHTVQRNQMLMTPTSAPRSVMKSFIKRNTPLRMDPKCSFVEKERQRLENLRRKEEAEQLRRQKVE    491 - 560
EDKRRRLEEVKLKREERLRKVLQARERVEQMKEEKKKQIEQKFAQIDEKTEKAKEERLAEEKAKKKAAAK    561 - 630
KMEEVEARRKQEEEARRLRWLQQEEEERRHQELLQKKKEEEQERLRKAAEAKRLAEQREQERREQERREQ    631 - 700
ERREQERREQERREQERQLAEQERRREQERLQAERELQEREKALRLQKEQLQRELEEKKKKEEQQRLAER    701 - 770
QLQEEQEKKAKEAAGASKALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDSTDDEAHPRK    771 - 840
PIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSPPLQGARVPSS    841 - 910
LAYSLKKH                                                                  911 - 918
//

Text Mined References (60)

PMID Year Title