Property Summary

NCBI Gene PubMed Count 46
Grant Count 57
R01 Count 50
Funding $4,971,127.28
PubMed Score 96.02
PubTator Score 67.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (20)

PMID Text
26460953 Data unveils a novel mechanism of PRMT1-mediated CPC regulation through methylation of INCENP.
25586992 The data suggest that INCENP in the chromosomal passenger complex pathway contributes to estrogen receptor-negative breast cancer susceptibility in the European population.
23848594 Our results provide the structural basis and energetics of the human Aurora-A(G198N) - INCENP complex
23562843 v-Src induces the failure of cytokinesis and the delocalization of Mklp1, Aurora B, and INCENP from the spindle midzone.
21875947 HIV-1 Vpr interferes with the heterochromatin structure by displacing HP1-alpha and HP1-gamma proteins in interphase, which leads to relocalization of the centromere chromatin proteins Mis12, Sgo1, and INCENP/CPC after prophase
21875947 HIV-1 Vpr interferes with the heterochromatin structure by displacing HP1-alpha and HP1-gamma proteins in interphase, which leads to relocalization of the centromere chromatin proteins Mis12, Sgo1, and INCENP/CPC after prophase
21346195 HP1alpha binding by INCENP or Shugoshin 1 (Sgo1) is dispensable for centromeric cohesion protection during mitosis of human cells, but might regulate yet unknown interphase functions of the chromosome passenger complex (CPC) or Sgo1 at the centromeres.
20619651 Dephosphorylation of INCENP at anaphase and the concomitant relocation of the chromosomal passenger protein complex prevents kinetochore recruitment of mitotic checkpoint proteins.
20372054 Results indicate that INCENP-Aurora B localized at centromeres/inner kinetochores is sufficient to mediate SAC activity upon spindle disruption.
19494039 Data show that binding to INCENP is alone critical to the distinct function of Aurora B, and although G198 of Aurora A is required for TPX2 binding, N142G Aurora B retains INCENP binding and Aurora B function.
More...

AA Sequence

MGTTAPGPIHLLELCDQKLMEFLCNMDNKDLVWLEEIQEEAERMFTREFSKEPELMPKTPSQKNRRKKRR      1 - 70
ISYVQDENRDPIRRRLSRRKSRSSQLSSRRLRSKDSVEKLATVVGENGSVLRRVTRAAAAAAAATMALAA     71 - 140
PSSPTPESPTMLTKKPEDNHTQCQLVPVVEIGISERQNAEQHVTQLMSTEPLPRTLSPTPASATAPTSQG    141 - 210
IPTSDEESTPKKSKARILESITVSSLMATPQDPKGQGVGTGRSASKLRIAQVSPGPRDSPAFPDSPWRER    211 - 280
VLAPILPDNFSTPTGSRTDSQSVRHSPIAPSSPSPQVLAQKYSLVAKQESVVRRASRRLAKKTAEEPAAS    281 - 350
GRIICHSYLERLLNVEVPQKVGSEQKEPPEEAEPVAAAEPEVPENNGNNSWPHNDTEIANSTPNPKPAAS    351 - 420
SPETPSAGQQEAKTDQADGPREPPQSARRKRSYKQAVSELDEEQHLEDEELQPPRSKTPSSPCPASKVVR    421 - 490
PLRTFLHTVQRNQMLMTPTSAPRSVMKSFIKRNTPLRMDPKCSFVEKERQRLENLRRKEEAEQLRRQKVE    491 - 560
EDKRRRLEEVKLKREERLRKVLQARERVEQMKEEKKKQIEQKFAQIDEKTEKAKEERLAEEKAKKKAAAK    561 - 630
KMEEVEARRKQEEEARRLRWLQQEEEERRHQELLQKKKEEEQERLRKAAEAKRLAEQREQERREQERREQ    631 - 700
ERREQERREQERREQERQLAEQERRREQERLQAERELQEREKALRLQKEQLQRELEEKKKKEEQQRLAER    701 - 770
QLQEEQEKKAKEAAGASKALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDSTDDEAHPRK    771 - 840
PIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSPPLQGARVPSS    841 - 910
LAYSLKKH                                                                  911 - 918
//

Text Mined References (56)

PMID Year Title
26460953 2015 PRMT1 promotes mitosis of cancer cells through arginine methylation of INCENP.
25586992 2015 Inherited variants in the inner centromere protein (INCENP) gene of the chromosomal passenger complex contribute to the susceptibility of ER-negative breast cancer.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
23848594 2013 Structural basis for binding of aurora-AG198N- INCENP complex: MD simulations and free energy calculations.
23562843 2013 v-Src causes delocalization of Mklp1, Aurora B, and INCENP from the spindle midzone during cytokinesis failure.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21829377 2011 Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21346195 2011 Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells.
21225229 2011 PAR, a protein involved in the cell cycle, is functionally related to chromosomal passenger proteins.
More...