Property Summary

NCBI Gene PubMed Count 11
Grant Count 4
R01 Count 4
Funding $639,419.5
PubMed Score 18.55
PubTator Score 9.20

Knowledge Summary

Patent (8,096)

Expression

Synonym

Accession Q9NQS5 B6V9G7
Symbols EX33
GPCR4

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (3)

PMID Text
25425658 concluded that diindolylmethane was a positive allosteric modulator for GPR84
25293777 A previously unrecognized role of GPR84 in maintaining fully developed acute myeloid leukemia by sustaining aberrant beta-catenin signaling in leukemic stem cells.
23449982 Medium-chain fatty acid-sensing receptor, GPR84, is a proinflammatory receptor.

AA Sequence

MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTLADLLYC      1 - 70
TLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLA     71 - 140
LVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCLIHRQVKRAAQ    141 - 210
ALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINS    211 - 280
KRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRV    281 - 350
VHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH                            351 - 396
//

Text Mined References (13)

PMID Year Title
25425658 2015 Mutation analysis and molecular modeling for the investigation of ligand-binding modes of GPR84.
25293777 2014 GPR84 sustains aberrant ?-catenin signaling in leukemic stem cells for maintenance of MLL leukemogenesis.
23449982 2013 Medium-chain fatty acid-sensing receptor, GPR84, is a proinflammatory receptor.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
19460454 2009 Free fatty acid receptors act as nutrient sensors to regulate energy homeostasis.
16966319 2006 Medium-chain fatty acids as ligands for orphan G protein-coupled receptor GPR84.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...