Property Summary

Ligand Count 8
NCBI Gene PubMed Count 11
PubMed Score 24.20
PubTator Score 9.20

Knowledge Summary

Patent (8,096)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.300 2.6e-04
glioblastoma 1.100 1.9e-04
head and neck cancer and chronic obstruc... 1.400 8.4e-04
invasive ductal carcinoma 1.300 2.1e-02
mucosa-associated lymphoid tissue lympho... 1.512 3.3e-02
osteosarcoma -3.147 1.9e-04
posterior fossa group A ependymoma 1.300 1.9e-05
psoriasis 2.400 4.2e-53
tuberculosis -4.400 9.8e-07
ulcerative colitis 1.500 4.5e-03

 GO Function (1)

Gene RIF (3)

AA Sequence

MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTLADLLYC      1 - 70
TLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLA     71 - 140
LVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCLIHRQVKRAAQ    141 - 210
ALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINS    211 - 280
KRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRV    281 - 350
VHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH                            351 - 396
//

Text Mined References (13)

PMID Year Title