Property Summary

NCBI Gene PubMed Count 31
Grant Count 5
R01 Count 3
Funding $236,828.9
PubMed Score 35.94
PubTator Score 22.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q9NQS3 E9PFR0 Q6NVZ3 Q8NC05 Q8WVU4 Q9BVA9 Q9Y412
Symbols PPR3
PRR3
CD113
PVRL3
PVRR3
CDW113
NECTIN-3

Gene

PANTHER Protein Class (1)

PDB

4FOM  

Gene RIF (10)

PMID Text
26602083 Data suggest that 3 independent regions of TcdB (Clostridium difficile toxin B; 1372-1493, 1493-1848, 1851-2366) contribute to binding and entry of TcdB into mammalian cells; residues 1372-1493 are sufficient for interaction with PVRL3.
26038560 PVRL3 is a physiologically relevant binding partner that can serve as a target for the prevention of TcdB-induced cytotoxicity in C. difficile infection.
25690753 Expression of nectin-3 in pancreatic cancer can be a prognostic factor.
24386110 Nectin-3 is associated with the formation of cell junctions and be a putative suppressor molecule to the invasion of breast cancer cells.
24116228 Nectin-3 trans-interacts with Nectin-2 to promote lymphocyte and monocyte extravasation.
23898208 HIV-1 Tat downregulates the expression of poliovirus receptor-related 3 (PVRL3) in human primary T cells
22926846 Data suggest that expression of nectin-3 is up-regulated in eutopic endometrium of patients with endometriosis as compared with control subjects and up-regulated in all endometriotic lesions investigated compared with eutopic endometrium.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARTLRPSPLCPGGGKAQLSSASLLGAGLLLQPPTPPPLLLLLFPLLLFSRLCGALAGPIIVEPHVTAVW      1 - 70
GKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGF     71 - 140
SDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDL    141 - 210
GEMESTTTSFPNETATIISQYKLFPTRFARGRRITCVVKHPALEKDIRYSFILDIQYAPEVSVTGYDGNW    211 - 280
FVGRKGVNLKCNADANPPPFKSVWSRLDGQWPDGLLASDNTLHFVHPLTFNYSGVYICKVTNSLGQRSDQ    281 - 350
KVIYISDPPTTTTLQPTIQWHPSTADIEDLATEPKKLPFPLSTLATIKDDTIATIIASVVGGALFIVLVS    351 - 420
VLAGIFCYRRRRTFRGDYFAKNYIPPSDMQKESQIDVLQQDELDSYPDSVKKENKNPVNNLIRKDYLEEP    421 - 490
EKTQWNNVENLNRFERPMDYYEDLKMGMKFVSDEHYDENEDDLVSHVDGSVISRREWYV               491 - 549
//

Text Mined References (34)

PMID Year Title
26602083 2015 Binding and entry of Clostridium difficile toxin B is mediated by multiple domains.
26038560 2015 Identification of an epithelial cell receptor responsible for Clostridium difficile TcdB-induced cytotoxicity.
25690753 2015 Nectin expression in pancreatic adenocarcinoma: nectin-3 is associated with a poor prognosis.
25416956 2014 A proteome-scale map of the human interactome network.
24386110 2013 The expression of the Nectin complex in human breast cancer and the role of Nectin-3 in the control of tight junctions during metastasis.
24116228 2013 Nectin-3 (CD113) interacts with Nectin-2 (CD112) to promote lymphocyte transendothelial migration.
23758976 2013 Nectin-2 is a potential target for antibody therapy of breast and ovarian cancers.
22926846 2012 Eutopic endometrium and peritoneal, ovarian and colorectal endometriotic tissues express a different profile of nectin-1, -3, -4 and nectin-like molecule 2.
22902367 2012 Nectin ectodomain structures reveal a canonical adhesive interface.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
More...