Property Summary

NCBI Gene PubMed Count 31
PubMed Score 41.75
PubTator Score 22.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma 1.471 2.2e-02
atypical teratoid / rhabdoid tumor -2.500 2.3e-04
ductal carcinoma in situ -1.100 1.2e-02
esophageal adenocarcinoma 1.100 2.4e-02
glioblastoma multiforme -1.100 5.5e-09
interstitial cystitis -1.200 4.8e-03
invasive ductal carcinoma -1.400 8.3e-03
lung adenocarcinoma -1.200 7.1e-10
lung cancer -1.900 2.3e-04
medulloblastoma -1.600 1.3e-02
medulloblastoma, large-cell -3.300 6.9e-03
pituitary cancer 3.100 3.0e-08
tuberculosis -1.400 6.9e-07
ulcerative colitis -1.200 4.0e-04

Protein-protein Interaction (10)

Gene RIF (11)

AA Sequence

MARTLRPSPLCPGGGKAQLSSASLLGAGLLLQPPTPPPLLLLLFPLLLFSRLCGALAGPIIVEPHVTAVW      1 - 70
GKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGF     71 - 140
SDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDL    141 - 210
GEMESTTTSFPNETATIISQYKLFPTRFARGRRITCVVKHPALEKDIRYSFILDIQYAPEVSVTGYDGNW    211 - 280
FVGRKGVNLKCNADANPPPFKSVWSRLDGQWPDGLLASDNTLHFVHPLTFNYSGVYICKVTNSLGQRSDQ    281 - 350
KVIYISDPPTTTTLQPTIQWHPSTADIEDLATEPKKLPFPLSTLATIKDDTIATIIASVVGGALFIVLVS    351 - 420
VLAGIFCYRRRRTFRGDYFAKNYIPPSDMQKESQIDVLQQDELDSYPDSVKKENKNPVNNLIRKDYLEEP    421 - 490
EKTQWNNVENLNRFERPMDYYEDLKMGMKFVSDEHYDENEDDLVSHVDGSVISRREWYV               491 - 549
//

Text Mined References (34)

PMID Year Title