Property Summary

NCBI Gene PubMed Count 31
PubMed Score 35.94
PubTator Score 22.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 7.13304109257191E-10
glioblastoma multiforme 347 5.53037681397271E-9
pituitary cancer 1972 2.99372247176056E-8
tuberculosis and treatment for 3 months 327 1.96337814611064E-6
atypical teratoid / rhabdoid tumor 4369 2.32531058018668E-4
lung cancer 4473 2.33829388512433E-4
ulcerative colitis 2087 3.99451514767043E-4
interstitial cystitis 2299 0.00476092250436669
medulloblastoma, large-cell 6234 0.00692499990489139
invasive ductal carcinoma 2950 0.00830460345831419
ductal carcinoma in situ 1745 0.0124199837746227
medulloblastoma 1524 0.0134160025593736
adrenocortical carcinoma 1427 0.021512979024479
esophageal adenocarcinoma 737 0.0238405656794597
Disease Target Count Z-score Confidence
Megaesophagus 3 3.539 1.8

Expression

  Differential Expression (14)

Synonym

Accession Q9NQS3 E9PFR0 Q6NVZ3 Q8NC05 Q8WVU4 Q9BVA9 Q9Y412
Symbols PPR3
PRR3
CD113
PVRL3
PVRR3
CDW113
NECTIN-3

Gene

PANTHER Protein Class (1)

PDB

4FOM  

  Ortholog (1)

Species Source
Mouse OMA EggNOG Inparanoid

Gene RIF (10)

PMID Text
26602083 Data suggest that 3 independent regions of TcdB (Clostridium difficile toxin B; 1372-1493, 1493-1848, 1851-2366) contribute to binding and entry of TcdB into mammalian cells; residues 1372-1493 are sufficient for interaction with PVRL3.
26038560 PVRL3 is a physiologically relevant binding partner that can serve as a target for the prevention of TcdB-induced cytotoxicity in C. difficile infection.
25690753 Expression of nectin-3 in pancreatic cancer can be a prognostic factor.
24386110 Nectin-3 is associated with the formation of cell junctions and be a putative suppressor molecule to the invasion of breast cancer cells.
24116228 Nectin-3 trans-interacts with Nectin-2 to promote lymphocyte and monocyte extravasation.
23898208 HIV-1 Tat downregulates the expression of poliovirus receptor-related 3 (PVRL3) in human primary T cells
22926846 Data suggest that expression of nectin-3 is up-regulated in eutopic endometrium of patients with endometriosis as compared with control subjects and up-regulated in all endometriotic lesions investigated compared with eutopic endometrium.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARTLRPSPLCPGGGKAQLSSASLLGAGLLLQPPTPPPLLLLLFPLLLFSRLCGALAGPIIVEPHVTAVW      1 - 70
GKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGF     71 - 140
SDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDL    141 - 210
GEMESTTTSFPNETATIISQYKLFPTRFARGRRITCVVKHPALEKDIRYSFILDIQYAPEVSVTGYDGNW    211 - 280
FVGRKGVNLKCNADANPPPFKSVWSRLDGQWPDGLLASDNTLHFVHPLTFNYSGVYICKVTNSLGQRSDQ    281 - 350
KVIYISDPPTTTTLQPTIQWHPSTADIEDLATEPKKLPFPLSTLATIKDDTIATIIASVVGGALFIVLVS    351 - 420
VLAGIFCYRRRRTFRGDYFAKNYIPPSDMQKESQIDVLQQDELDSYPDSVKKENKNPVNNLIRKDYLEEP    421 - 490
EKTQWNNVENLNRFERPMDYYEDLKMGMKFVSDEHYDENEDDLVSHVDGSVISRREWYV               491 - 549
//

Text Mined References (34)

PMID Year Title
26602083 2015 Binding and entry of Clostridium difficile toxin B is mediated by multiple domains.
26038560 2015 Identification of an epithelial cell receptor responsible for Clostridium difficile TcdB-induced cytotoxicity.
25690753 2015 Nectin expression in pancreatic adenocarcinoma: nectin-3 is associated with a poor prognosis.
25416956 2014 A proteome-scale map of the human interactome network.
24386110 2013 The expression of the Nectin complex in human breast cancer and the role of Nectin-3 in the control of tight junctions during metastasis.
24116228 2013 Nectin-3 (CD113) interacts with Nectin-2 (CD112) to promote lymphocyte transendothelial migration.
23758976 2013 Nectin-2 is a potential target for antibody therapy of breast and ovarian cancers.
22926846 2012 Eutopic endometrium and peritoneal, ovarian and colorectal endometriotic tissues express a different profile of nectin-1, -3, -4 and nectin-like molecule 2.
22902367 2012 Nectin ectodomain structures reveal a canonical adhesive interface.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
More...