Property Summary

NCBI Gene PubMed Count 23
Grant Count 5
R01 Count 4
Funding $528,114.5
PubMed Score 28.19
PubTator Score 25.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.176 0.009
malignant mesothelioma -1.500 0.000
psoriasis 1.700 0.000
lung cancer 2.000 0.000
ovarian cancer 2.700 0.000

Gene RIF (18)

PMID Text
26267306 The Aven RGG/RG motif bound G4 structures within the coding regions of the MLL1 and MLL4 mRNAs increasing their polysomal association and translation, resulting in the induction of transcription of leukemic genes.
25757065 The findings implicate Aven in ATR-Chk1 signalling and point towards Chk1 inhibition as a strategy to sensitize human osteosarcomas to chemotherapy.
25573060 the expression of Aven is regulated by the Akt signaling pathway through cathepsin D activity, which contributes to the sensitivity of cancer cells to chemotherapeutic agents.
22751129 Overexpression of the anti-apoptotic protein AVEN contributes to increased malignancy in hematopoietic neoplasms.
22388353 a model of Aven activation by which its N-terminal inhibitory domain is removed by CathD-mediated proteolysis, thereby unleashing its cytoprotective function.
21718987 The results suggest that deregulation of the expression of the apoptosis inhibitor Aven may be related to male factor infertility.
20935510 Results suggest that the regulation of Exportin-1/CRM1-dependent nucleocytoplasmatic traffic of Aven could modulate its ability to influence cell cycle progression.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGG      1 - 70
APRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTD     71 - 140
FSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLE    141 - 210
VPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGD    211 - 280
HLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTE    281 - 350
EELEDWLDSMIS                                                              351 - 362
//

Text Mined References (29)

PMID Year Title
26267306 2015 Aven recognition of RNA G-quadruplexes regulates translation of the mixed lineage leukemia protooncogenes.
25757065 2015 Aven-mediated checkpoint kinase control regulates proliferation and resistance to chemotherapy in conventional osteosarcoma.
25573060 2015 Akt regulation of Aven contributes to the sensitivity of cancer cells to chemotherapeutic agents.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22751129 2013 Overexpression of the anti-apoptotic protein AVEN contributes to increased malignancy in hematopoietic neoplasms.
22388353 2012 The Apaf-1-binding protein Aven is cleaved by Cathepsin D to unleash its anti-apoptotic potential.
21718987 2011 Apoptosis-inhibitor Aven is downregulated in defective spermatogenesis and a novel estrogen target gene in mammalian testis.
20935510 2010 Regulation of the ATM-activator protein Aven by CRM1-dependent nuclear export.
More...