Property Summary

NCBI Gene PubMed Count 60
PubMed Score 87.67
PubTator Score 54.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 1.4e-07
psoriasis 6694 4.2e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
diabetes mellitus 1728 4.745 2.4
Insulinoma 24 3.106 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.515 1.4e-07
psoriasis -1.500 4.2e-07

Gene RIF (58)

AA Sequence

MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWVAVIGDWLNLI      1 - 70
FKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGASCVWYVMVTAALSHTVCGMDK     71 - 140
FSITLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVILGVIGGMLVAEAFEHTPGIQTASLGTYLKT    141 - 210
NLFLFLFAVGFYLLLRVLNIDLLWSVPIAKKWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLL    211 - 280
SCRGGNNYTLSFRLLCALTSLTILQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYSVHMLMKQS    281 - 350
GKKSQ                                                                     351 - 355
//

Text Mined References (63)

PMID Year Title