Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -2.100 6.5e-05
Astrocytoma, Pilocytic -2.700 2.1e-11
glioblastoma -2.300 3.9e-10
group 4 medulloblastoma -1.300 3.1e-03
Multiple Sclerosis -2.400 7.4e-04
oligodendroglioma -1.100 1.4e-17
subependymal giant cell astrocytoma -2.645 1.2e-03

AA Sequence

MVDPVPEEEKAGAEPGDSGGDEAVASVPPDSQGAQEPAASSASASASAAVPRKAEVPCAAAEGGRREQSP      1 - 70
LLHLDLFNFDCPEAEGSRYVLTSPRSLEACARCAVKPVELLPRALADLVREAPGRSMRVATGLYEAYEAE     71 - 140
RRAKLQQCRAERERIMREEKRRLFTPLSPAAAAAAAAAAASAPSAGSSSSCSSASLPASPAPRAARKASP    141 - 210
SPSSARTQPPPAGSRTGRKSHSLDSLSRRREGALSSESGASSSSYSGESLRELRWPPRASARNSCPAGSA    211 - 280
SSTTNAPGRPSALTLVPITGRSFSLGDLSHSPQTAQHVERIVRQVRAERGLRGVPERDRKIAALMLARHQ    281 - 350
EELLLLEQRAAAHGQWELQRVHAKQRREREEREKQRALEQGRRAWAAQVEERRGRRGREEREAARRRQRQ    351 - 420
YERSEERRRELAERQGLLRRERAERAAREDRLRKLQQEQNLKQREEGLQEGRERAEQIRRERAQRAARAK    421 - 490
QRQEGQLQREKRELSRAERARHEALLQGRTRQQRQEREGLRSSLEASLGRAQENYEHLVEQRTRELRERA    491 - 560
RREELQGRRAKEAAERKEREHQAHLEALARAGERRLQHATQVAEEAVQQKARRVGQSRLEKERAQRANKE    561 - 630
KVERDEDCRRRELLQAIGRKLERSEQLTRERRSALESARSTARASFHVREKVREETNTRSFDRMVREAQL    631 - 700
HASLDRK                                                                   701 - 707
//

Text Mined References (4)

PMID Year Title