Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9NQR7 B2R5G1 Q2M359
Symbols PLPL
C14orf162

Gene

 Compartment GO Term (0)

AA Sequence

MVDPVPEEEKAGAEPGDSGGDEAVASVPPDSQGAQEPAASSASASASAAVPRKAEVPCAAAEGGRREQSP      1 - 70
LLHLDLFNFDCPEAEGSRYVLTSPRSLEACARCAVKPVELLPRALADLVREAPGRSMRVATGLYEAYEAE     71 - 140
RRAKLQQCRAERERIMREEKRRLFTPLSPAAAAAAAAAAASAPSAGSSSSCSSASLPASPAPRAARKASP    141 - 210
SPSSARTQPPPAGSRTGRKSHSLDSLSRRREGALSSESGASSSSYSGESLRELRWPPRASARNSCPAGSA    211 - 280
SSTTNAPGRPSALTLVPITGRSFSLGDLSHSPQTAQHVERIVRQVRAERGLRGVPERDRKIAALMLARHQ    281 - 350
EELLLLEQRAAAHGQWELQRVHAKQRREREEREKQRALEQGRRAWAAQVEERRGRRGREEREAARRRQRQ    351 - 420
YERSEERRRELAERQGLLRRERAERAAREDRLRKLQQEQNLKQREEGLQEGRERAEQIRRERAQRAARAK    421 - 490
QRQEGQLQREKRELSRAERARHEALLQGRTRQQRQEREGLRSSLEASLGRAQENYEHLVEQRTRELRERA    491 - 560
RREELQGRRAKEAAERKEREHQAHLEALARAGERRLQHATQVAEEAVQQKARRVGQSRLEKERAQRANKE    561 - 630
KVERDEDCRRRELLQAIGRKLERSEQLTRERRSALESARSTARASFHVREKVREETNTRSFDRMVREAQL    631 - 700
HASLDRK                                                                   701 - 707
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.