Property Summary

NCBI Gene PubMed Count 11
PubMed Score 59.66
PubTator Score 21.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
breast carcinoma 1.100 3.5e-03
glioblastoma 1.100 1.3e-02
group 3 medulloblastoma 1.100 2.4e-02
lung cancer 1.500 2.1e-04
Multiple myeloma 1.780 1.2e-04
osteosarcoma -1.044 4.4e-02
ovarian cancer 1.700 2.3e-04
Pick disease -1.200 1.7e-04
subependymal giant cell astrocytoma 1.410 3.6e-02

Synonym

Accession Q9NQR4 B2R9A3 D3DN47 Q8WUF0
Symbols HEL-S-8a

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (4)

AA Sequence

MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEKIPGESTQKLS      1 - 70
EVAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFST     71 - 140
FDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRSRAVDNQVYVATASPAR    141 - 210
DDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP        211 - 276
//

Text Mined References (19)

PMID Year Title