Property Summary

NCBI Gene PubMed Count 11
PubMed Score 58.33
PubTator Score 21.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Multiple myeloma 1328 1.19390111568052E-4
Pick disease 1893 1.65200995326903E-4
lung cancer 4473 2.05813810898484E-4
ovarian cancer 8492 2.33399719366424E-4
breast carcinoma 1614 0.00346855662385528
glioblastoma 5572 0.012687129725241
group 3 medulloblastoma 2254 0.0238857981657153
subependymal giant cell astrocytoma 2287 0.0362649887512173
osteosarcoma 7933 0.0441954848509933

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.780 0.000
osteosarcoma -1.044 0.044
glioblastoma 1.100 0.013
lung cancer 1.500 0.000
breast carcinoma 1.100 0.003
group 3 medulloblastoma 1.100 0.024
subependymal giant cell astrocytoma 1.410 0.036
Pick disease -1.200 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q9NQR4 B2R9A3 D3DN47 Q8WUF0
Symbols HEL-S-8a

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
25738796 Downregulation of NIT2 inhibits colon cancer cell proliferation and induces cell cycle arrest through the caspase-3 and PARP pathways
25008847 Human NIT1/2 are not involved in the metabolism of vildagliptin.
22674578 The activity and substrate specificity of human Nit2 was determined with alpha-ketoglutaramate and succinamate as substrates.
17488281 Genotype analysis in 4 types of tumor tissue showed allelic imbalance surrounding NIT2 locus; results show that NIT2 plays an important role in cell growth inhibition & links to malignancies, suggesting Nit2 may be a potential tumor suppressor candidate

AA Sequence

MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEKIPGESTQKLS      1 - 70
EVAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFST     71 - 140
FDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRSRAVDNQVYVATASPAR    141 - 210
DDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP        211 - 276
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25738796 2015 Downregulation of NIT2 inhibits colon cancer cell proliferation and induces cell cycle arrest through the caspase-3 and PARP pathways.
25008847 2014 Human nitrilase-like protein does not catalyze the hydrolysis of vildagliptin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22674578 2012 Structural insights into the catalytic active site and activity of human Nit2/?-amidase: kinetic assay and molecular dynamics simulation.
21269460 2011 Initial characterization of the human central proteome.
19595734 2009 Identification of the putative tumor suppressor Nit2 as omega-amidase, an enzyme metabolically linked to glutamine and asparagine transamination.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...