Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
R01 Count 1
Funding $122,474.5
PubMed Score 58.33
PubTator Score 21.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.780 0.000
osteosarcoma -1.044 0.044
glioblastoma 1.100 0.013
lung cancer 1.500 0.000
breast carcinoma 1.100 0.003
group 3 medulloblastoma 1.100 0.024
subependymal giant cell astrocytoma 1.410 0.036
Pick disease -1.200 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q9NQR4 B2R9A3 D3DN47 Q8WUF0
Symbols HEL-S-8a

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (4)

PMID Text
25738796 Downregulation of NIT2 inhibits colon cancer cell proliferation and induces cell cycle arrest through the caspase-3 and PARP pathways
25008847 Human NIT1/2 are not involved in the metabolism of vildagliptin.
22674578 The activity and substrate specificity of human Nit2 was determined with alpha-ketoglutaramate and succinamate as substrates.
17488281 Genotype analysis in 4 types of tumor tissue showed allelic imbalance surrounding NIT2 locus; results show that NIT2 plays an important role in cell growth inhibition & links to malignancies, suggesting Nit2 may be a potential tumor suppressor candidate

AA Sequence

MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEKIPGESTQKLS      1 - 70
EVAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFST     71 - 140
FDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRSRAVDNQVYVATASPAR    141 - 210
DDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP        211 - 276
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25738796 2015 Downregulation of NIT2 inhibits colon cancer cell proliferation and induces cell cycle arrest through the caspase-3 and PARP pathways.
25008847 2014 Human nitrilase-like protein does not catalyze the hydrolysis of vildagliptin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22674578 2012 Structural insights into the catalytic active site and activity of human Nit2/?-amidase: kinetic assay and molecular dynamics simulation.
21269460 2011 Initial characterization of the human central proteome.
19595734 2009 Identification of the putative tumor suppressor Nit2 as omega-amidase, an enzyme metabolically linked to glutamine and asparagine transamination.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...