Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.75
PubTator Score 5.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 7.6e-05
osteosarcoma 7950 2.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.036 2.1e-02
ovarian cancer 1.400 7.6e-05

Gene RIF (1)

AA Sequence

MGRWALDVAFLWKAVLTLGLVLLYYCFSIGITFYNKWLTKSFHFPLFMTMLHLAVIFLFSALSRALVQCS      1 - 70
SHRARVVLSWADYLRRVAPTALATALDVGLSNWSFLYVTVSLYTMTKSSAVLFILIFSLIFKLEELRAAL     71 - 140
VLVVLLIAGGLFMFTYKSTQFNVEGFALVLGASFIGGIRWTLTQMLLQKAELGLQNPIDTMFHLQPLMFL    141 - 210
GLFPLFAVFEGLHLSTSEKIFRFQDTGLLLRVLGSLFLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKE    211 - 280
VCTLLLAAHLLGDQISLLNWLGFALCLSGISLHVALKALHSRGDGGPKALKGLGSSPDLELLLRSSQREE    281 - 350
GDNEEEEYFVAQGQQ                                                           351 - 365
//

Text Mined References (21)

PMID Year Title