Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.29

Knowledge Summary

Patent (304)

Gene RIF (1)

AA Sequence

MEKANETSPVMGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPMYFFLGNLSFL      1 - 70
DICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNPLRYSVIMSKA     71 - 140
AYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTCEILAVLKLACADISINVISMEVTNVIFLGV    141 - 210
PVLFISFSYVFIITTILRIPSAEGRKKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKL    211 - 280
IPLFYGVVTPMLNPIIYSLRNKDVKAAVRRLLRPKGFTQ                                   281 - 319
//

Text Mined References (10)

PMID Year Title