Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.00

Knowledge Summary

Patent (304)

Gene RIF (1)

PMID Text
20677014 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEKANETSPVMGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPMYFFLGNLSFL      1 - 70
DICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNPLRYSVIMSKA     71 - 140
AYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTCEILAVLKLACADISINVISMEVTNVIFLGV    141 - 210
PVLFISFSYVFIITTILRIPSAEGRKKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKL    211 - 280
IPLFYGVVTPMLNPIIYSLRNKDVKAAVRRLLRPKGFTQ                                   281 - 319
//

Text Mined References (10)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14983052 2004 The human olfactory receptor gene family.
12906860 2003 Organization and evolutionary relatedness of OR37 olfactory receptor genes in mouse and human.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10452948 1999 Small subfamily of olfactory receptor genes: structural features, expression pattern and genomic organization.