Property Summary

NCBI Gene PubMed Count 14
Grant Count 3
Funding $11,806.75
PubMed Score 4.99
PubTator Score 1.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Synonym

Accession Q9NQL2 A8K184 Q7L8F9 Q9NPG0 Rag D
Symbols RAGD
bA11D8.2.1

Gene

PDB

2Q3F  

Gene RIF (2)

PMID Text
24095279 FLCN and its binding partners, FNIP1/2, are Rag-interacting proteins with GAP activity for RagC/D, but not RagA/B.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSQVLGKPQPQDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPFSTEVKPRILLMGL      1 - 70
RRSGKSSIQKVVFHKMSPNETLFLESTNKICREDVSNSSFVNFQIWDFPGQIDFFDPTFDYEMIFRGTGA     71 - 140
LIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLE    141 - 210
KIHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDM    211 - 280
QTYELCCDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFLALVCFVREESFERK    281 - 350
GLIDYNFHCFRKAIHEVFEVRMKVVKSRKVQNRLQKKKRATPNGTPRVLL                        351 - 400
//

Text Mined References (17)

PMID Year Title
25567906 2015 Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25259925 2014 Sestrins function as guanine nucleotide dissociation inhibitors for Rag GTPases to control mTORC1 signaling.
24095279 2013 The folliculin tumor suppressor is a GAP for the RagC/D GTPases that signal amino acid levels to mTORC1.
22575674 2012 SH3BP4 is a negative regulator of amino acid-Rag GTPase-mTORC1 signaling.
22424946 2012 Leucyl-tRNA synthetase is an intracellular leucine sensor for the mTORC1-signaling pathway.
20381137 2010 Ragulator-Rag complex targets mTORC1 to the lysosomal surface and is necessary for its activation by amino acids.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18497260 2008 The Rag GTPases bind raptor and mediate amino acid signaling to mTORC1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...