Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.82
PubTator Score 1.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Barrett's esophagus -1.400 2.9e-02
Breast cancer -2.500 1.2e-10
colon cancer 2.100 3.9e-02
cutaneous lupus erythematosus -1.200 1.1e-02
cystic fibrosis -1.100 6.7e-04
ductal carcinoma in situ -1.300 3.5e-02
esophageal adenocarcinoma -2.000 2.1e-02
group 4 medulloblastoma -1.300 1.3e-02
intraductal papillary-mucinous adenoma (... -2.200 1.1e-03
intraductal papillary-mucinous carcinoma... -2.300 5.2e-03
intraductal papillary-mucinous neoplasm ... -2.300 5.2e-03
invasive ductal carcinoma -1.600 2.4e-02
lung cancer -1.900 4.3e-03
malignant mesothelioma 5.200 3.1e-09
medulloblastoma, large-cell -2.100 1.2e-03
Multiple myeloma 2.156 1.4e-02
osteosarcoma -2.015 5.5e-03
ovarian cancer 1.300 1.4e-04
psoriasis -1.700 3.2e-08
Rheumatoid arthritis 1.100 1.1e-02

Gene RIF (4)

AA Sequence

MSQVLGKPQPQDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPFSTEVKPRILLMGL      1 - 70
RRSGKSSIQKVVFHKMSPNETLFLESTNKICREDVSNSSFVNFQIWDFPGQIDFFDPTFDYEMIFRGTGA     71 - 140
LIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLE    141 - 210
KIHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDM    211 - 280
QTYELCCDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFLALVCFVREESFERK    281 - 350
GLIDYNFHCFRKAIHEVFEVRMKVVKSRKVQNRLQKKKRATPNGTPRVLL                        351 - 400
//

Text Mined References (19)

PMID Year Title