Property Summary

NCBI Gene PubMed Count 18
Grant Count 2
Funding $292,835
PubMed Score 72.53
PubTator Score 26.39

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

 Grant Application (2)

Gene RIF (11)

PMID Text
25747659 Data show that intrinsically disordered N terminus of DEAD-box RNA helicase Ddx4 forms organelles in HeLa cells and in vitro.
24727449 this study reports the first analysis and comparison of the expression patterns and colocalization of DDX4 and CD133 in 59 ovarian cancer patients via tissue microarray and immunofluorescence analysis to identify the expression patterns and relationship of those two markers in ovarian cancer cells.
23315064 Data suggest that VASA shows differential expression in ovary; in resting primordial follicle reserve in childhood/pre-puberty, VASA is associated with Balbiani's body space in germ cell; once follicle enters growing pool, VASA is undetectable.
22288104 Vasa/Ddx4 gene can be involved in regulation of ground and primed states of pluripotency
22162380 overexpression of VASA and or DAZL, in both embryonic and induced pluripotent stem cells promoted differentiation into primordial germ cells, and maturation and progression through meiosis was enhanced.
19937754 Report the generation/characterization of embryonic stem cell lines carrying a VASA-pEGFP-1 reporter construct that expresses GFP in a population of differentiating cells showing expression of characteristic markers of primordial germ cells.
19629140 Highly methylated regions of the VASA gene are associated with maturation arrest phenotype in the testis.
18805576 Over-expression of VASA abrogates the G2 checkpoint, induced by DNA damage, by down-regulating the expression of 14-3-3sigma. Results suggest that VASA may play a role in the progression of ovarian cancer or serve as a valuable marker of tumorigenesis.
18534994 VASA showed a differential pattern of expression throughout the differentiation and proliferative phase and prophase I to finally associate with Balbiani's body in primordial and primary follicles.
17486274 The expression of VASA mRNA and protein was significantly decreased in the sperm of oligozoospermic men.
More...

AA Sequence

MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDA      1 - 70
GECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGGYRDGNNSE     71 - 140
ASGPYRRGGRGSFRGCRGGFGLGSPNNDLDPDECMQRTGGLFGSRRPVLSGTGNGDTSQSRSGSGSERGG    141 - 210
YKGLNEEVITGSGKNSWKSEAEGGESSDTQGPKVTYIPPPPPEDEDSIFAHYQTGINFDKYDTILVEVSG    211 - 280
HDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHM    281 - 350
MHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQIVQGCNILC    351 - 420
ATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSATFPEEIQR    421 - 490
LAAEFLKSNYLFVAVGQVGGACRDVQQTVLQVGQFSKREKLVEILRNIGDERTMVFVETKKKADFIATFL    491 - 560
CQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGR    561 - 630
TGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKG    631 - 700
KSTLNTAGFSSSQAPNPVDDESWD                                                  701 - 724
//

Text Mined References (21)

PMID Year Title
25747659 2015 Phase transition of a disordered nuage protein generates environmentally responsive membraneless organelles.
24727449 2014 DDX4 (DEAD box polypeptide 4) colocalizes with cancer stem cell marker CD133 in ovarian cancers.
23315064 2013 The infant and pubertal human ovary: Balbiani's body-associated VASA expression, immunohistochemical detection of apoptosis-related BCL2 and BAX proteins, and DNA fragmentation.
22288104 [Expression patterns of germ line specific genes in mouse and human pluripotent stem cells are associated with regulation of ground and primed state of pluripotency].
22162380 2012 Divergent RNA-binding proteins, DAZL and VASA, induce meiotic progression in human germ cells derived in vitro.
21421998 2011 NANOS3 function in human germ cell development.
21034600 2010 Spermatozoal protein profiles in male infertility with asthenozoospermia.
19937754 2010 Expression of GFP under the control of the RNA helicase VASA permits fluorescence-activated cell sorting isolation of human primordial germ cells.
19629140 2009 Tissue-specific differentially methylated regions of the human VASA gene are potentially associated with maturation arrest phenotype in the testis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...