Property Summary

NCBI Gene PubMed Count 15
PubMed Score 17.28
PubTator Score 20.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.700 5.9e-06
medulloblastoma, large-cell 1.100 3.6e-05
oligodendroglioma 1.300 2.0e-03
osteosarcoma 1.884 4.1e-05
ovarian cancer -1.400 6.6e-06
pancreatic ductal adenocarcinoma liver m... -1.385 1.8e-02
Pick disease 1.300 1.1e-05

Gene RIF (4)

AA Sequence

MPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQV      1 - 70
EYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLP     71 - 140
GKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPS    141 - 210
HAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEA    211 - 280
FLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVN    281 - 350
GRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKYCPH    351 - 420
HVGHYLGMDVHDTPDMPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPLILSA    421 - 490
DCPKEMNDIEQICSQAS                                                         491 - 507
//

Text Mined References (19)

PMID Year Title