Property Summary

NCBI Gene PubMed Count 24
PubMed Score 8.23
PubTator Score 7.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
pituitary cancer 1972 5.4e-07
tuberculosis and treatment for 6 months 409 1.4e-04
lung cancer 4740 1.8e-02
Breast cancer 3578 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Optic Atrophy 242 3.49 1.7

Gene RIF (10)

AA Sequence

MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRS      1 - 70
WEEPNWMGSPRLLNRDMKTGLSRSLQTLPTDSSTFDTDTFCPPRPKPVARKGQVDLKKSRLRMSLQEKLL     71 - 140
TYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVL    141 - 210
EQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIG    211 - 280
SLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLR    281 - 350
ALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLE    351 - 420
AGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQT                               421 - 463
//

Text Mined References (32)

PMID Year Title