Property Summary

NCBI Gene PubMed Count 23
Grant Count 2
R01 Count 2
Funding $90,326.24
PubMed Score 7.63
PubTator Score 7.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
tuberculosis and treatment for 6 months 1.100 0.000
lung cancer 1.100 0.018
Breast cancer 2.700 0.026
pituitary cancer 1.300 0.000

Synonym

Accession Q9NQG6 Q7L890 Q9BUI3
Symbols MID51
SMCR7L
HSU79252
dJ1104E15.3

Gene

 Grant Application (2)

PDB

4NXT   4NXU   4NXV   4NXW   4NXX  

 GO Function (2)

Gene RIF (9)

PMID Text
26903540 The results indicate that Drp1-dependent mitochondrial fission through MiD49/MiD51 regulates cristae remodeling during intrinsic apoptosis.
24817717 The cytoplasmic domain of MiD51 was overexpressed, purified and crystallized.
23921378 MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and suggest that they provide specificity to the division of mitochondria.
23880462 MIEF1 and MIEF2 are differentially expressed in human tissues during development
23283981 we find that either MiD49 or MiD51 can mediate Drp1 recruitment and mitochondrial fission in the absence of Fis1 and Mff
21701560 elevated MIEF1 levels induce mitochondrial fusion; depletion of MIEF1 causes mitochondrial fragmentation; MIEF1 interacts with and recruits Drp1 to mitochondria but inhibits Drp1 activity, executing a negative effect on mitochondrial fission
21508961 MiD49/51 are new mediators of mitochondrial division affecting Drp1 action at mitochondria.
21508961 Mitochondrial outer membrane protein that recruits fission mediator Drp1 to the mitochondrial surface.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRS      1 - 70
WEEPNWMGSPRLLNRDMKTGLSRSLQTLPTDSSTFDTDTFCPPRPKPVARKGQVDLKKSRLRMSLQEKLL     71 - 140
TYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVL    141 - 210
EQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIG    211 - 280
SLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLR    281 - 350
ALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLE    351 - 420
AGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQT                               421 - 463
//

Text Mined References (31)

PMID Year Title
26903540 2016 Drp1-dependent mitochondrial fission via MiD49/51 is essential for apoptotic cristae remodeling.
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
25416956 2014 A proteome-scale map of the human interactome network.
24817717 2014 Expression, purification, crystallization and preliminary crystallographic study of the cytoplasmic domain of the mitochondrial dynamics protein MiD51.
24515348 2014 Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23921378 2013 Adaptor proteins MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and are specific for mitochondrial fission.
23880462 2013 The mitochondrial elongation factors MIEF1 and MIEF2 exert partially distinct functions in mitochondrial dynamics.
23530241 2013 Interchangeable adaptors regulate mitochondrial dynamin assembly for membrane scission.
23283981 2013 Fis1, Mff, MiD49, and MiD51 mediate Drp1 recruitment in mitochondrial fission.
More...