Property Summary

NCBI Gene PubMed Count 16
PubMed Score 19.36
PubTator Score 8.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.961 0.001

Synonym

Accession Q9NQG5 Q1WDE7 Q6PKF4
Symbols CREPT
NET60
C20orf77
dJ1057B20.2

Gene

PDB

4FLA   4FU3   4HFG   4NAD   4Q94   4Q96  

Gene RIF (7)

PMID Text
26819409 a detailed description of proteins associating with K-H/RPRD1B in higher-order protein complexes is required to further elucidate its role in various cellular processes
25400738 CREPT displays unique immunostaining for retroperitoneal leiomyosarcoma tissue and can be used to supplement other currently available markers.
24997600 RPRD1A and RPRD1B associate directly with RPAP2 phosphatase and coordinate the dephosphorylation of RNAPII phospho-S5 by RPAP2.
24982424 study suggests that CREPT acts as an activator to promote transcriptional activity of the beta-catenin.TCF4 complex in response to Wnt signaling.
24589584 This study reports that K-H functions in RNAPII regulation, and aids in stabilizing interactions between transcription termination factors, localizing Xrn2 to the 3'-end of genes and ultimately suppressing R-loop formation.
24452636 RPRD1B overexpression promotes tumor growth and accelerates cell cycle progression.
22264791 CREPT increases cyclin D1 transcription during tumorigenesis.

AA Sequence

MSSFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNS      1 - 70
KRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKAT     71 - 140
EEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQD    141 - 210
VSLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDVLSEKEKKLEEYK    211 - 280
QKLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD                            281 - 326
//

Text Mined References (25)

PMID Year Title
26819409 2016 The Kub5-Hera/RPRD1B interactome: a novel role in preserving genetic stability by regulating DNA mismatch repair.
25545209 2014 Characterization of a monoclonal antibody against CREPT, a novel protein highly expressed in tumors.
25400738 2014 CREPT expression correlates with poor prognosis in patients with retroperitoneal leiomyosarcoma.
24997600 2014 RPRD1A and RPRD1B are human RNA polymerase II C-terminal domain scaffolds for Ser5 dephosphorylation.
24982424 2014 CREPT/RPRD1B, a recently identified novel protein highly expressed in tumors, enhances the ?-catenin·TCF4 transcriptional activity in response to Wnt signaling.
24589584 2014 Kub5-Hera, the human Rtt103 homolog, plays dual functional roles in transcription termination and DNA repair.
24452636 2014 RPRD1B promotes tumor growth by accelerating the cell cycle in endometrial cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22264791 2012 CREPT accelerates tumorigenesis by regulating the transcription of cell-cycle-related genes.
More...