Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.06
PubTator Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.3e-04
medulloblastoma, large-cell 6241 1.5e-03

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.300 1.5e-03
ovarian cancer -1.100 1.3e-04

Synonym

Accession Q9NQG1 A8KAA6 E1P5V3
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAV      1 - 70
PSVNKRPKKETKKKR                                                            71 - 85
//

Text Mined References (7)

PMID Year Title