Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
inflammatory breast cancer 286 4.9e-02
Disease Target Count Z-score Confidence
Cervical squamous cell carcinoma 10 3.359 1.7

Gene RIF (1)

AA Sequence

MAENAAPGLISELKLAVPWGHIAAKAWGSLQGPPVLCLHGWLDNASSFDRLIPLLPQDFYYVAMDFGGHG      1 - 70
LSSHYSPGVPYYLQTFVSEIRRVVAALKWNRFSILGHSFGGVVGGMFFCTFPEMVDKLILLDTPLFLLES     71 - 140
DEMENLLTYKRRAIEHVLQVEASQEPSHVFSLKQLLQRQRTALTSSAGSCVRIPSGSCRPMSC           141 - 203
//

Text Mined References (8)

PMID Year Title