Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.84
PubTator Score 1.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.100 5.7e-03
Amyotrophic lateral sclerosis -1.245 6.2e-03
atypical teratoid / rhabdoid tumor -1.500 3.7e-03
autosomal dominant Emery-Dreifuss muscul... -1.293 4.3e-02
Breast cancer 2.800 2.9e-02
ductal carcinoma in situ -1.600 2.0e-03
ependymoma -1.200 2.4e-06
glioblastoma -1.300 5.0e-03
group 4 medulloblastoma 1.100 5.7e-03
hepatocellular carcinoma 1.600 8.0e-04
invasive ductal carcinoma -1.800 4.0e-04
limb girdle muscular dystrophy 2A -1.369 9.0e-03
medulloblastoma, large-cell -1.600 5.0e-04
non primary Sjogren syndrome sicca 1.300 1.4e-02
non-small cell lung cancer -1.654 2.5e-15
osteosarcoma 1.017 3.8e-02
ovarian cancer -1.100 2.0e-03
pancreatic cancer 1.700 3.3e-02
pancreatic carcinoma 1.700 3.3e-02
psoriasis -1.200 8.8e-21
tuberculosis and treatment for 6 months 1.100 1.0e-03

Gene RIF (1)

AA Sequence

MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAGKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENED      1 - 70
LICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCS     71 - 140
ISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT                                141 - 182
//

Text Mined References (14)

PMID Year Title