Property Summary

NCBI Gene PubMed Count 12
Grant Count 5
R01 Count 5
Funding $2,385,201
PubMed Score 39.35
PubTator Score 11.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -1.700 0.000
osteosarcoma -1.407 0.003
glioblastoma -1.400 0.000
medulloblastoma -1.600 0.000
medulloblastoma, large-cell -1.300 0.005
primitive neuroectodermal tumor -1.500 0.002
primary pancreatic ductal adenocarcinoma -1.302 0.003
lung cancer -1.300 0.015
interstitial cystitis -1.700 0.000
pediatric high grade glioma -1.100 0.000
pilocytic astrocytoma -1.300 0.000
Breast cancer -1.700 0.000

Gene RIF (7)

PMID Text
22488895 The genes HIST1H2BJ, PRSS16, and PGBD1 were not associated with Japanese patients with schizophrenia.
22384243 ZNF804a regulates expression of the schizophrenia-associated genes PRSS16, COMT, PDE4B, and DRD2
19571809 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19295542 our results identify PRSS16 and BTN3A2, two genes thought to play important roles in regulating the immune response, as potentially novel susceptibility genes for Type I diabetes.
19295542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17584581 data suggest that it is unlikely that polymorphisms within the PRSS16 gene are involved in the predisposition to diabetes type 1
12140752 The gene encoding thymus-specific serine protease (PRSS16) maps to the extended HLA complex, which harbours several genes predisposing for autoimmune diseases.

AA Sequence

MAVWLAQWLGPLLLVSLWGLLAPASLLRRLGEHIQQFQESSAQGLGLSLGPGAAALPKVGWLEQLLDPFN      1 - 70
VSDRRSFLQRYWVNDQHWVGQDGPIFLHLGGEGSLGPGSVMRGHPAALAPAWGALVISLEHRFYGLSIPA     71 - 140
GGLEMAQLRFLSSRLALADVVSARLALSRLFNISSSSPWICFGGSYAGSLAAWARLKFPHLIFASVASSA    141 - 210
PVRAVLDFSEYNDVVSRSLMSTAIGGSLECRAAVSVAFAEVERRLRSGGAAQAALRTELSACGPLGRAEN    211 - 280
QAELLGALQALVGGVVQYDGQTGAPLSVRQLCGLLLGGGGNRSHSTPYCGLRRAVQIVLHSLGQKCLSFS    281 - 350
RAETVAQLRSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPALPSQLDLCEQVFGLSALSVAQ    351 - 420
AVAQTNSYYGGQTPGANKVLFVNGDTDPWHVLSVTQALGSSESTLLIRTGSHCLDMAPERPSDSPSLRLG    421 - 490
RQNIFQQLQTWLKLAKESQIKGEV                                                  491 - 514
//

Text Mined References (12)

PMID Year Title
22488895 2012 No associations found between the genes situated at 6p22.1, HIST1H2BJ, PRSS16, and PGBD1 in Japanese patients diagnosed with schizophrenia.
22384243 2012 ZNF804a regulates expression of the schizophrenia-associated genes PRSS16, COMT, PDE4B, and DRD2.
19571809 2009 Common variants on chromosome 6p22.1 are associated with schizophrenia.
19571808 2009 Common variants conferring risk of schizophrenia.
19295542 2009 Reproducible association with type 1 diabetes in the extended class I region of the major histocompatibility complex.
17584581 2007 Association analysis in type 1 diabetes of the PRSS16 gene encoding a thymus-specific serine protease.
15592422 2005 Alternatively spliced transcripts of the thymus-specific protease PRSS16 are differentially expressed in human thymus.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12140752 2002 Polymorphisms in the gene encoding thymus-specific serine protease in the extended HLA complex: a potential candidate gene for autoimmune and HLA-associated diseases.
More...