Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.41
PubTator Score 2.97

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.800 3.1e-02
lung cancer 1.100 3.9e-03

 GO Function (1)

Gene RIF (1)

AA Sequence

MADNSSDECEEENNKEKKKTSQLTPQRGFSENEDDDDDDDDSSETDSDSDDDDEEHGAPLEGAYDPADYE      1 - 70
HLPVSAEIKELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKPDNLGLLVLDEPSTK     71 - 140
QSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDTWIESISELHRSKPPATVHYTRPMPDIDTL    141 - 210
MQEWSPEFEELLGKVSLPTAEIDCSLAEYIDMICAILDIPVYKSRIQSLHLLFSLYSEFKNSQHFKALAE    211 - 280
GKKAFTPSSNSTSQAGDMETLTFS                                                  281 - 304
//

Text Mined References (16)

PMID Year Title